Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G094988-GRMZM2G015861
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100193210

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSENLARYSAWLGGAILAKVVFPENQHITKGEYDETGRLLCTRSAFRDKLP*

MEAVVVDAGSKLLKAGIAAPDQAPPLVMPSKMKLDVEDQEMADGAVVEEVVHPVVRGFVK
DWDAMEDLLNYVLYRDIGWEIGDEGQILFTEPLFTPKTLREQLVQLMFEKFNVSGFYASE
QAVLSLYAVGRISGCTVDIGHGKIDIAPVCEGAVQHIASKRLEIGGVDLTNLFAQELKKS
NPSVNLDVADVELLKEQYACCTEDYLTFESIESSCQPEKHTLPDGQVITIEKEGYIVGEA
LFQPRILGLEDYGIVHQLVTSVSNVSSEYHRQLLENTMLCGGTSSMTGFEDRFQREANLS
ASAICPSLVKPPEYMPENLARYSAWLGGAILAKVVFPQNQHVTKGEYDETGPSIVHKKCF
*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):51GC content 2 (%):49GC content divergence:-0.02
Length 1 (bp):156Length 2 (bp):1083Length divergence:0.748
MFE 1 (kcal):-49MFE 2 (kcal):-371.16MFE divergence0.767