Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G095078-GRMZM2G171370
Species:maize
Duplication type:WGD
Function (paralog1):maize Em binding protein-1a
Function (paralog2):DNA-binding protein EMBP-1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.55491986531417
Log2 mRNA fold difference:0.26364775304268
Log2 TE fold difference:0.26429950512558
Sequences
Protein sequence

MASSSDEQSKPPEPPAAAAVVTAAAPPQTHAEWVASLQAYYAAAGHPYAWPAQHLMAAAA
AGAHFGTPVPFPVYHPGAAAAYYAHASMAAGVPYPTCEAVPAVALPTVPEGKGKGKGGGA
SPEKGSSGAPSGEDASRSDDSGSDESSETRDDDTDHKDSSAPKKRKSGNTSAEGEPSQAT
VVRYAAVESPYPAKGRSASKLPVSAPGRAALPSATPNLNIGMDIWNASPALAVPAVQGEV
SPGLALARRDGVTQLDEREIKRERRKQSNRESARRSRLRKQQECEELARKVADLTTENSA
LRAELDNLKKACQDMEAENSRLLGGVADAQVPSVTTTLGMSIEPPKLQLQLQQHHDEEGQ
LHKKSSNNSNGNCAGGSHKPEANTTR*

MASSSDEQPKPPEPPAAAVVAAPPQTHAEWAASLQAYYAAAGHPYAWPAQHLMAAAAAGA
PFGTPVPFPVYHPGAAAAYYAHASMAAGVPYPTSEAVATVAAATAPEGKGKGKGGGASPE
KGSSGAPSGEDDSRSSDSGSDESSETRDDDTDHKGSSAPKKRKSGNTSAEGEPSQAAVVR
YATVESPYPAKGRSASKLPVSAPGRAALPSATPNLNIGMDIWNTSPALAVPAVQGEANPG
LALARRDSVTQLDERELKRERRKQSNRESARRSRLRKQQECEELARKVADLTTENSALRA
ELDNLRKACQDMEAENSRLLVSTVPSVTTTLGMSIEPPKAQQHHDDEGQLHKKSSNNSNG
KGSHKPEANTR*

Other information
Ka divergence:-0.209748KaKs divergence:0.206074
GC content 1 (%):60GC content 2 (%):61GC content divergence:0.008
Length 1 (bp):1161Length 2 (bp):1116Length divergence:-0.02
MFE 1 (kcal):-489.2MFE 2 (kcal):-479.41MFE divergence-0.01