Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G095261-GRMZM2G395508
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.9505116163571
Log2 mRNA fold difference:-1.1527805490998
Log2 TE fold difference:-1.9157150394226
Sequences
Protein sequence

MATPALVLLPEWGSGHLMSMLESCKRVLLSSSGGKAFSITLLVMRPPTAEATSEVEAHVR
REAACGLDIRFHRLPAVEAPTDAVGVEEFIARYIGLHAPHVRDAVAAMACPVAALVLDLF
AAPLVDVARGLGVPSYVFMSSTGAMLALMLHLPVLHESVPAVDFDEMEGDVPLPGLPPVP
PDSMPCPVADKRSPNYACFVRLGDRFMDATGVIANTADELEPGPLAAVARGRCVPGRPAP
PVYPIGPVLSLGGRSPSHECVAWLDAQPPGSVAFLCFGSMGWFDPPQVAEITAALERCGH
RFLWVLRGPPSDASGSEHPTDANLDELLPEGFLERTGGKGLVWPTWAPQKEILAHPAVGG
FVTHGGWNSVLESLWHGVPMAPWPLYAEQHLNAFQLVADMGVAVPLKVDRKRGNFVVAAE
LERAVRSLMDADGEQGRRAREKAARMKAVCRKAVEEGGSSHAALQRLAEALHDGAVIPKK
*

MASLNVLLLPEPGSGHLMSLIEAGKRLLGHGAGGGDGLGREFTVTVLVVRPPTPESAAEV
GAHVRRVAESGIAGVRFHHLPAVEPPADCAGNLQEFKSRYLELHRPHVEAAARELGAAAL
VVDFFATAVLDVARGLAVPAYVYFTSTAALLALTLRLPALAETVAADFETFEGTVDVPGL
PPVPAASVPGFLGRKDSPNFTWFVYHGRRFMDADGIVVNTVAELEPGLLAAIAGGRCVPG
RPAPPLYPIGPVLNLGAGGGASGDEACVRWLDAQPRASVVFLCFGSLGWFDAAKAREAAA
GLERSGHRFLWALRGPPAAGSRHPSDADLDELLPAGFLERTRGRGLVWPRWAPQKAVLAH
PAVGGFVTHCGWNSTMESLWHGVPLAPWPLYAEQHLNAFELVAVVGVAVAMEVDRRRDNF
VEAAELERAVRALMGGGEEGRKAREKAHEMKAACRKAVEERGSSYAALERLRHAIRKGAN
TATAHFKAPQPLI*

Other information
Ka divergence:-0.585012KaKs divergence:0.0959556
GC content 1 (%):73GC content 2 (%):73GC content divergence:0
Length 1 (bp):1443Length 2 (bp):1482Length divergence:0.013
MFE 1 (kcal):-810.5MFE 2 (kcal):-851.9MFE divergence0.025