Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G095299-GRMZM2G019335
Species:maize
Duplication type:WGD
Function (paralog1):LOC100284784 (gpm454), mRNA
Function (paralog2):hypothetical protein LOC100273793

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MKIQCDACEGAAATVVCCADEAALCARCDVEIHAANKLASKHQRLPLEALSAKLPRCDVC
QEKAAFIFCVEDRALFCQDCDEPIHVPGTLSGNHQRYLATGIRVGLASASACSDACDAHD
SDHHAPPKATIEPPHAAVSAAVQQVPSPPQFLPQGWAVDELLQFSDYESSDKLHKEPTLG
FKELEWFADIDLFHEQAPKASRTLADVPELFGYQAANDAAYYRPAKPPSAALGFARAKKG
PDRGHRRRGLPHSP*

MKIQCDACEGAAATVVCCADEAALCARCDVEIHAANKLASKHQRLPLEALSASLPRCDVC
QEKAAFIFCVEDRALFCRDCDEPIHVPGTLSGNHQRYLATDIRVGFASASSACSDACDAH
DDSDHHAPPKAAVSSAAQQVPSPPQFLPQGWAVDELLQFSDCESSDKLHKESPLGFKELE
WFTDIDLFHEQTPKAGRRLAEVPELSGTQAANDAAYYRPAKATATAGAGVRQSKKARTEV
TDDEDHLIVPDLG*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):69GC content 2 (%):69GC content divergence:0
Length 1 (bp):765Length 2 (bp):762Length divergence:-0.002
MFE 1 (kcal):-348.31MFE 2 (kcal):-342.73MFE divergence-0.008