Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G095763-GRMZM2G061885
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191489
Function (paralog2):hypothetical protein LOC100273525

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSFLRRRKPLPPSDGDESDHDDNDKGKKPSSSSGSPSKEPTKRTKAKWSCVDSCCWLVGC
VCSAWWLLLFLYNAMPASFPQYVTEAITGPLPDPPGVKLQKEGLRVKHPVVFVPGIVTGG
LELWEGHHCAEGLFRKRLWGGTFGDVYKRPLCWVEHMSLDNETGLDKPGIRVRPVTGLVA
ADYFVPGYFVWAVLIANLARIGYEEKTMYMAAYDWRLSFQNTEVRDQTLSRIKSNIELMV
ATNGGNRVVVIPHSMGVLYFLHFMKWVEAPPPMGGGGGPDWCEKHIKAVMNIGGPFLGVP
KAVAGLFSSEAKDVAVARAIAPDVLDSDFLGLQTLRHLMRMTRTWDSTMSMIPKGGDTIW
GNLDWSPEDGIECKAKKHKANDTGVSKDSNGGNIEVQPEPINYGRLVSFGKDVAEAPSSE
IEQIEFRDAVKGNNIAHSNTSCREIWTEYHELGWGGIKAVADYKVYTASSVVDLLHFVAP
RMMQRGNVHFSYGIADNLDDPKYQHYKYWSNPLETKLPNAPDMEIFSMYGVGIPTERAYV
YKLAPQAECYIPFRIDTSAEGGEENSCLKGGVYLADGDETVPVLSAGYMCAKGWRGKTRF
NPAGSKTYVREYSHSPPSTLLEGRGTQSGAHVDIMGNFALIEDVIRIAAGATGEEIGGDQ
VYSDIFKWSEKIKLKL*

MSLLRRRKQQQLPPSEGDGSDHDDNDKGKKPSSSSAPPSKEPTRRTKAKWSCVDSCCWLV
GCVCSAWWLLLFLYNAMPASFPQYVTEAITGPLPDPPGVKLQKEGLRAKHPVVFVPGIVT
GGLELWEGHQCAEGLFRKRLWGGTFGDVYKRPLCWVEHMSLDNETGLDKPGIRVRSVTGL
VAADYFVPGYFVWAVLIANLARIGYEEKTMYMAAYDWRLSFQNTEVRDQTLSRIKSNIEL
MVATNGGNRVVVIPHSMGVLYFLHFMKWVEAPPPMGGGGGPNWCEKHIKAVMNIGGPFLG
VPKAVAGLFSSEAKDVAVARAIAPDVLDSDFLGLQTLRHLMRMTRTWDSTMSMLPKGGDT
IWGNLDWSPEDGLECKAKKHKTNDTEVSKDSNGENIEVQPEPINYGRLVSFGKDVAEAPS
SEIEQIEFRDAVKGNDIVHSNASCREIWTEYHELGWGGIKAVADYKVYTASSVIDLLHFV
APRMMQRGNVHFSYGIADNLDDPKYQHYKYWSNPLETKLPNAPDMEIISMYGVGIPTERA
YVYKLAPQAECYIPFRIDASADGGEENKCLKGGVYLADGDETVPVLSAGYMCAKGWRGKT
RFNPAGSKTYVREYSHSPPSTLLEGRGTQSGAHVDIMGNFALIEDIIRIAAGATGEEIGG
DQVYSDIFKWSEKIKLKL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):2031Length 2 (bp):2037Length divergence:0.001
MFE 1 (kcal):-708.5MFE 2 (kcal):-718.4MFE divergence0.007