Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G095904-GRMZM2G127857
Species:maize
Duplication type:WGD
Function (paralog1):R2R3MYB-domain protein Fragment
Function (paralog2):myb-related protein Myb4

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.23745427531976
Log2 mRNA fold difference:-2.1648264406343
Log2 TE fold difference:2.2564045002756
Sequences
Protein sequence

MGRAPCCEKMGLKRGPWTPEEDRILVAHIERHGHSNWRALPKQAGLPRCGKSCRLRWINY
LRPDIKRGNFTREEEDAVIQLHQMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLEPKT
ATQAPKRKPKKQQQPEAVTLAAPVSPEQSVSTSTTSTTTDYSAASSSLENADSFTSEEED
YQIDDSFWSETLAMAVDSSDSGMEEAEGAFGASPPAPSTNDDVDFWLKLFMQASDMQNSP
QIYA*

MGRSPCCEKMGLKRGPWTAEEDRILVAHVERHGHSNWRALPKQAGLLRCGKSCRLRWINY
LRPDIKRGNFSREEEDAIIQLHQMLGNRWSTIAARLPGRTDNEIKNVWHTHLKKRLEPKP
ASQQAPKRKPTKKQQPQPEPEPVTTLEGPAGAVPPVAPERSLSTTTSTTTSTADYSPASS
LENAGDSFTSEEDYYQIDDSFWSETLAMTTTVDSFESGVQQAEGSFGKSAAAPSSTNDDM
DFWLKLFMQASDMQNLPQII*

Other information
Ka divergence:0.182104KaKs divergence:0.466111
GC content 1 (%):64GC content 2 (%):66GC content divergence:0.015
Length 1 (bp):735Length 2 (bp):783Length divergence:0.032
MFE 1 (kcal):-316.46MFE 2 (kcal):-349.7MFE divergence0.05