Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G095968-GRMZM2G127072
Species:maize
Duplication type:WGD
Function (paralog1):expansin-like 3
Function (paralog2):hypothetical protein LOC100383815

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.3214741814941
Log2 mRNA fold difference:-1.3077120959998
Log2 TE fold difference:-0.0052075576737956
Sequences
Protein sequence

MSVPPARLAASSLPLLLVWLQLQLLLASACDRCVRHSKAAYYTSALTLAGGSCGYGTDAA
SFSAGFLAAASPALYRAGVGCGACFQVRCKDKKLCGAAGARVVVTDRARTNRTDLVLSST
AFAAMARPGMAPRLAARRAVDVEYKRVPCEYKHRNLSVRVEERSHAAAPAPGDLAIRFLY
QGGQTDIVAVDVAQECMQVGSSNWRFMTRDDGPAWSTRQAPPGPLQLRVVVTGGYDGKWV
WADREVLPRWRRAGEVYDTGVQITDVAQEGCFPCDTHEWEEE*

MAVPVGRLAASTLLQLLVWLPLPASACDRCVRHSKAAYYYTSSLTLAGGSCGYGTEAASF
SAGLLAAAGPALYRGGAGCGACFQVRCKDRKLCGAAGARVVVTDRARTNGTDLVLSSTAF
AAMARPGMARRLAGLRAVDIEYKSAARAHVQGAVRVQAQEPVGEGAGEEALPGGPWRPRH
QVSLPGRPDRHRRRRRRAGGLVQLEVHDAPQRRAGVEHEAGAGGAAPAQGGGDGRLRRQV
GVGGARGAAAAAARRRGLRHGRPDHRRRPGGMLPLRHARVGVMRMWTNHASDGRSRSRSR
KPNAEASTQLKSLPVELL*

Other information
Ka divergence:0.92341KaKs divergence:-0.758333
GC content 1 (%):72GC content 2 (%):71GC content divergence:-0.007
Length 1 (bp):849Length 2 (bp):957Length divergence:0.06
MFE 1 (kcal):-443.5MFE 2 (kcal):-493.3MFE divergence0.053