Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G096100-GRMZM2G103512
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273935
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.41681631880001
Log2 mRNA fold difference:0.2924389388244
Log2 TE fold difference:-0.69072285405197
Sequences
Protein sequence

MAKVHLYVAAACAVVLALATPALAGDPDMLQDVCPADYASPVKLNGFACKANFSADDFFF
DGLRNPGNTNNPAGSVVTAANVEKFPGVNTLGVSMARIDYAPGGQNPPHTHPRATEIIFV
LEGTLEVGFITTANALFTKTVTKGDVFVFPRGLVHFQQNRGHGPAAVVAAFNSQLQGTQA
IAMTLFGAVPPVPSDILAKAFRISSGEVDHIKANFAPK*

MARIHLYVVAAACAVALALAGDPDMLQDVCVADYASPVKLNGFPCKANVSADDFFFDGLR
SPGNTNNPAGSAVTAANVDKFPGVNTLGVSMARIDYAPGGQNPPHTHPRATEIIFVLEGT
LEVGFLTTANRLLSKTVATGDVFVFPRGLVHFQQNRGHGPAAVVAAFNSQLQGTQAIAMT
LFGATPPVPTDILAKAFRVGSGEVEHIKANFAPK*

www.000webhost.com

Other information
Ka divergence:0.143644KaKs divergence:0.648815
GC content 1 (%):68GC content 2 (%):69GC content divergence:0.007
Length 1 (bp):657Length 2 (bp):645Length divergence:-0.009
MFE 1 (kcal):-284.8MFE 2 (kcal):-299.1MFE divergence0.024