Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G096269-GRMZM2G126781
Species:maize
Duplication type:WGD
Function (paralog1):glutathione S-transferase12
Function (paralog2):glutathione transferase13

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.9787063612044
Log2 mRNA fold difference:-2.7073225855127
Log2 TE fold difference:0.72710671980512
Sequences
Protein sequence

MDRRLVFIEAHRISVWLTSPAAGLVSVIQRIALNRCSASSPNTHRSNRAMAAGLQVFGQP
ASTDVARVLTCLFEKNLEFELVRTDTFKKSHKLPEFIKLRDPTGQVTFKHGDKTIVDSRT
ICRYLCTQFPDDGYKKLYGTGSLERASIEQWLQAEAQSFDAPSSELAFQLAFAPHLKDVR
PDEARVAENEKKLHSMLGVYDDILSKNEYLAGDDFTLADLSHLPNSHYIVNSSDRGRKLF
TARKHVARWYDKISTRDSWRQVMKMQREHPGAFE*

MAAGLQVFGQPASTDVARVLTCLFEKNLEFELIRTDTFKKSHKLPEFIKLRDPTGQVTFK
HGDKTIVDSRAICRYLCTQFPDDGYKKLYGTGSLERASIEQWLQAEAQSFDAPSSELAFQ
LAFAPHLKNVRPDEARAAENERKLHGMLGVYDDILSKNEYLAGDDFTLADLSHLPNSHYI
VNSSDRGRKLFTARKHVARWYDKISTRDSWRQVIKMQREHPGAFE*

Other information
Ka divergence:0.599001KaKs divergence:0.965517
GC content 1 (%):62GC content 2 (%):63GC content divergence:0.008
Length 1 (bp):825Length 2 (bp):678Length divergence:-0.098
MFE 1 (kcal):-330.81MFE 2 (kcal):-276.8MFE divergence-0.089