Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G096546-GRMZM5G810191
Species:maize
Duplication type:TD
Function (paralog1):LOC100286337
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.45472557508714
Log2 mRNA fold difference:-0.66009109158234
Log2 TE fold difference:0.1846833290245
Sequences
Protein sequence

MKSMGSRDKLAAASSPRRVLLVVFAFCFAFATFLTFLYTTSHFTTAPGSGSGSIAASTTT
TTTTTSGSAGGGGGQGQAGPESVSKRLPVPVFEALVHFASISNATHRMSDTDIRAMSSVL
RARAPCNLLVFGLGAESPLWLALNHGGRTVFLEENEFYVKYLEPRHPGMEAYDVSYTTKV
RDFRDLLAAARAARAKECRPVQNLLFSECRLAINDLPNDLYDVAWDVVLIDGPSGWNPNS
PGRMPSIFTTAVLARSGATAAKGPTDVLVHDFQFEVEQVLSREFLCDENRVAGSGTPSLG
HFVIRGGGAGAGDAFCSAQEDGSSGEKTRRRRSRK*

MKSMGSRDKLAAASSPRRVLLVVFAFCFAFATFLTFLYTTSHFTTAPGSGSGSIAASTTT
TTTTTSGSAGGGGGQGQAGPESVSKRLPVPVFEALVHFASISNATHRMSDTDIRAMSSVL
RARAPCNLLVFGLGAESPLWLGAEPRIGSGRVGNGNGSGINGIAKTNGNGNTNGNS*

Other information
Ka divergence:1KaKs divergence:-0.700655
GC content 1 (%):70GC content 2 (%):66GC content divergence:-0.029
Length 1 (bp):1008Length 2 (bp):531Length divergence:-0.31
MFE 1 (kcal):-508.62MFE 2 (kcal):-245.5MFE divergence-0.349