Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G096553-GRMZM2G173137
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100280058

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.68824967439179
Log2 mRNA fold difference:0.5373117463925
Log2 TE fold difference:0.11113696312588
Sequences
Protein sequence

MPTSSSMRLPAMALSSSSPRSTSPPRYQSVGVNEEDKAAPSAEADHSQALESFRSLCGDA
DCNALRGLLEKVSGEGGGDVSPVILSPDADKAHRSEVHNFFKKTFKFLVTDTVEHSDGVQ
KCIRVRFGSEAGVGRGAGGRGRGRKRKNMGSSDWRDGRPFDSRGSSNWPDNVGKFLRFHL
YKENKDTQEALGVIGKMLGLQPRSFGFAGTKDKRAVTTQQVTVFKVQASKLLALNKRLFG
IKVGNFCYVKEGLVLGQLTGNRFTITLRGVTAESEDMIKIAVDGLGKNGFINYYGLQRFG
SGSIPTHLVGAALLRGEWKVAVNLILDPREGERDDINEVRKRYKEHGDIDMALRNFPRHL
VAERAILQCLKKCPGNHLQALKGIPRTLRMMYVHSYQSYLWNHAASMRVEKYGISQVVEG
DLVYNKECPSEESTSVDILETDDDHTNSIEIDLCSEAQPEESIQSAKIVDSGDFTKGIYT
FDDVVLPLPGSQALFPGNEIAEIYHEMARKDGISLTENAHGVKEFSITSMKGGYRRVFQR
PIGFEWELITYTDDTSSLAETDLDVLSRTKPKEANELISKQESQDKLEKAPDTSVPTNGN
SSQEKLIGSPDIRPKKLALKLAFTLPTSCYATMAIRELLKTSTSVAYQKTLSC*

MARSTSLSEAEAGISCFASSLPGFRGVLKHRYADFIVHEVARDGALVQLTSFDLPTESVG
VNEEDKAAPSAEADHSQALESFRSLCGDADCNALRGLLEKVSGEGGGDVSPVILSPDADK
AHRSEVHNFFKKTFKFLVTDTVEHSDGVQKCIRVRFGSEAGVGRGAGGRGRGRKRKNMGS
SDWRDGRPFDSRGSSNWPDNVGKFLRFHLYKENKDTQEALGVIGKMLGLQPRSFGFAGTK
DKRAVTTQQVTVFKVQASKLLALNKRLFGIKVGNFCYVKEGLVLGQLTGNRFTITLRGVT
AESEDMIKIAVDGLGKNGFINYYGLQRFGSGSIPTHLVGAALLRGEWKVAVNLILDPREG
ERDDINEVRKRYKEHGDIDMALRNFPRHLVAERAILQCLKKCPGNHLQALKGIPRTLRMM
YVHSYQSYLWNHAASMRVEKYGISQVVEGDLVYNKECPSEESTSVDILETDDDHTNSIEI
DLCSEAQPEESIQSAKIVDSGDFTKGIYTFDDVVLPLPGSQALFPGNEIAEIYHEMARKD
GISLTENAHGVKEFSITSMKGGYRRVFQRPIGFEWELITYTDDTSSLAETDLDVLSRTKP
KEANELISKQESQDKLEKAPDTSVPTNGNSSQEKLIGSPDIRPKKLALKLAFTLPTSCYA
TMAIRELLKTSTSVAYQKTLSC*

www.000webhost.com

Other information
Ka divergence:-0.925387KaKs divergence:-0.999779
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1962Length 2 (bp):2049Length divergence:0.022
MFE 1 (kcal):-640.95MFE 2 (kcal):-682.26MFE divergence0.031