Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G096600-GRMZM2G173198
Species:maize
Duplication type:TD
Function (paralog1):CXC domain containing TSO1-like protein 1
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.75758362089616
Log2 mRNA fold difference:1.0869523612685
Log2 TE fold difference:-0.33561626945823
Sequences
Protein sequence

MEATPISMKPPAPPPVTLEPIELSTHAVGLTELERSSMNQLAIAPDPKRQRVEEAADGNG
CKHCACKKSRCLKLYCPCFAGGGYCSDKCGCQPCFNKEAFSETVQTTRKVLLSRQKRMSM
KINRRPEANAEPMEDAHHSSSSTPPRRGCNCKKSSCLKKYCDCYQDGTGCSLFCRCDDCQ
NPFGKNDGIIADDSKRYLYTGADLDHSEGEHDFVVERSPRLQSPMSKESSFHQTPPHLRA
SSRDAHVFPQAVSQWQALPRSWHCSNKRNGNDRAMDDSSANGNYKSSSHDWQMSKLEDGY
SISRCVQILNGMVELSQVEKSVAPDVFLLPGNREIFVSLGGDVRAMWLKRKIQHLA*

MLCKSHKYTITVCICSYCPCFAGGGYCSDKCGCQPCFNKEAFSETVQTTRKVLLSRQKRM
SMKINRRPEANAEPMEDAHHSSSSTPPRRGCNCKKSSCLKKYCDCYQDGTGCSLFCRCDD
CQNPFGKNDGIIADDSKRYLYTGADLDHSEGEHDFVVERSPRLQSPMSKESSFHQTPPHL
RASSRDAHVFPQAVSQWQALPRSWHCSNKRNGNDRAMDDSSANGNYKSSSHDWQMSKLED
GYSISRCVQILNGMVELSQVEKSVAPDVFLLPGNREIFVSLGGDVRAMWLKRKIQHLA*

Other information
Ka divergence:1KaKs divergence:-0.0319694
GC content 1 (%):55GC content 2 (%):53GC content divergence:-0.019
Length 1 (bp):1071Length 2 (bp):897Length divergence:-0.088
MFE 1 (kcal):-395.4MFE 2 (kcal):-310.6MFE divergence-0.12