Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G096690-GRMZM2G054012
Species:maize
Duplication type:WGD
Function (paralog1):LOC100282946
Function (paralog2):LOC100284182

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNSS
EK*

MGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAYKRMQYNRRFVTAVVGFGKKRGPNSS
EK*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):62GC content 2 (%):64GC content divergence:0.016
Length 1 (bp):189Length 2 (bp):189Length divergence:0
MFE 1 (kcal):-67.9MFE 2 (kcal):-75.4MFE divergence0.052