Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G096753-GRMZM2G135091
Species:maize
Duplication type:WGD
Function (paralog1):phosphoenolpyruvate carboxylase kinase 3
Function (paralog2):phosphoenolpyruvate carboxylase kinase 2

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.6681466282642
Log2 mRNA fold difference:0.66759283297858
Log2 TE fold difference:1.0802426010587
Sequences
Protein sequence

MSAELKRDYEIGAEIGRGRFGVVHRCTSRASGEAFAVKSVDRSRLGDDLDRELAELEPKL
AQVAGAGNPGVVQVHAVYEDEAWTHVVMDLCAGPDLLEWVRIRRGAPVPEPVAAAIVAQV
AQALALCHRRGVAHRDVKPDNILIDAAAAAAGTDGDGDGEDEEEEGGDGEAEAAPRARLA
DFGSAAWVGAGGLGRAEGLVGTPHYVAPEVVGGGEYGAKADVWSAGVVMYALLSGGALPF
GGESAAEVLAAVLRGSARFPPRLFGGVSPAAKDLMRRMICRDEWRRFTAEQVLVHVHVHA
FLILQGVEKHFSSSGNTPSPLSSLSKSNTPSVVWLESVQLEKVLELEYELAFSLRL*

MSAELKRDYEIGEEIGRGRFGVVHRCTSRATGEAYAVKSVDRSRLGDDLDRELAQLEPKL
AQLAGAGNPGVVQVHAAYEDEAWTHVVMDLCPGPDLLEWVGRRRGAPVPEPVAAAIVAQV
AQALALCHRRGVAHRDVKPENILIDAAAGSDDDEEDEAEAAPRARLADFGSAAWVGAGGL
GRAEGLVGTPHYVAPEVVAGGEYGAKADVWSAGVVMYALLSGGALPFGGDSAAEVLAAVL
RGSARFPPRLFGGVSPAAKDLMRRMICRDEWRRFTAEQVLGEFFRSFPRQPLSCSVDLIS
PCSSMQFI*

Other information
Ka divergence:-0.00332405KaKs divergence:0.19395
GC content 1 (%):70GC content 2 (%):73GC content divergence:0.021
Length 1 (bp):1071Length 2 (bp):927Length divergence:-0.072
MFE 1 (kcal):-583.1MFE 2 (kcal):-521.2MFE divergence-0.056