Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G096877-GRMZM2G098797
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100273042

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.83532184587258
Log2 mRNA fold difference:-0.4545303723692
Log2 TE fold difference:-0.39642074701717
Sequences
Protein sequence

MPSRPQSILGLSAVPFPRRNPSSSPRRRAVRCPSPRLRAPSLLPSHLMFFSRNAFRDLDP
IDSPASMASSKKVATRDEWERKLRDVKIRKEDMNRLVMNFLVTEGFVDAADKFRIESGTQ
PEIDLAIIADRMEVKRAVQSGNVQEAIEKINDLNPTILDMNPQLYFHLQQQKLIELIREG
KTNEALEFAQEELAPRGEENQTFLEEIEKTVALLIFKGVKNCPYRELLDVSQRLKTASEV
NAAILASQSHGKDSKLPSLLKMLKWTQNHLDERAAYPAINDFTTAVVEDPSI*

MFLSRIVLRDLDSIDSPASMASSKKVVTRDEWELKLRDVKIRKEDMNRLVMNFLVTEGFV
DAADKFRIESGTQPEIDLATITDRMEVKRAVQSGNVQEAIEKINDLNPTILDTNPQLYFH
LQQQKLIELIRVGKINEALEFAQEELAPRGEENQTFLEEIEKTVALLVFEDVKNCPYGEL
LDVSQRLKTASEVNAAILTSQSHEKDPKLPSLLKMLKWTQNQLDEKAAYPRINDFTTAAL
EDPSI*

www.000webhost.com

Other information
Ka divergence:-0.895102KaKs divergence:-0.871068
GC content 1 (%):51GC content 2 (%):48GC content divergence:-0.03
Length 1 (bp):879Length 2 (bp):738Length divergence:-0.087
MFE 1 (kcal):-271.24MFE 2 (kcal):-223.63MFE divergence-0.096