Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G097109-GRMZM2G412229
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100274109

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.1134988356502
Log2 mRNA fold difference:-0.57692393655898
Log2 TE fold difference:-1.4677362280052
Sequences
Protein sequence

MATASLLEATRLLSTPRPPRRSLHTHLLRTPRLSALRAHLHRSATLDAQEPTARPGALLV
LDALRRSVVDSLAALKRPALALLLAGALLAAASMGGPHAAALAASGGRVGGSAFSSRSSS
PPSYGYSAPAPRGGYTAAPYYSPSPFVSFGPAVGIGFGGSGFLVTLIGFAAFLYLAGFLS
DSSGGTSVLTETDKTTVLKLQVGLLGMARSFQKELDQIAEKADTSTPAGLSYVLTETTLA
LLRHPDCCISAYSSVDVKRSVDDGEKRFNQLSIEERGKFDEETLVNVNSIKRNKGGSQRS
SGFSNEYIVITILVAAEGVHKLPVINSSNDLKTALQKMGAIPSSKILAVEVLWTPQNEND
TLSERELLEDYPLLRPL*

MAAASLLEATRFLSTPHPRSRSRPLPFPPGSGLHPHLLRTPRLSTLRVHLHRPAPLGAQE
PARPGALLAVDALRRSVLDSLAALKRPALALLLAGVLLAAASAGGPHAAALAASGGRVGG
SAFSSRSSSPRSYGYSAPAPRGGYTAAPFYSPSPFVSVGPALGIGFGGSGFLVTLMGFAA
FLYLAGFLSDSSGATSVLTETEKTTVLKLQVGLLGMARSFQKELDQIAEKADTSTPAGLS
YVLTETTLALLRHPDCCISAYSSVDVKRSIDNGEKRFNQLSIEERGKFDEETLVNVNSIK
RNKGGSQRSSGFSNEYIVITILVAAEGVHKVPVINSSNDLKTALQKMGAIPSRKILAVEV
LWTPQNENDTLSERELLEDYPLLRPL*

Other information
Ka divergence:-0.0382573KaKs divergence:0.0625281
GC content 1 (%):59GC content 2 (%):60GC content divergence:0.008
Length 1 (bp):1134Length 2 (bp):1161Length divergence:0.012
MFE 1 (kcal):-452.2MFE 2 (kcal):-458.46MFE divergence0.007