Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G097164-GRMZM2G111566
Species:maize
Duplication type:WGD
Function (paralog1):proteasome subunit beta type 2
Function (paralog2):proteasome subunit beta type 2

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.2600778478917
Log2 mRNA fold difference:-0.037072954610137
Log2 TE fold difference:0.34575711358264
Sequences
Protein sequence

MECVLGVVGRDFALVAADTSAVQSILVHKTDEDKVMVLDSQKLMGASGEPGDRVQFTEFI
QKNLHLYQFRNTIPLSTAAAANFTRGELATALRKNPYMVNIILGGYDKDVGASLYYIDYI
ATLHKIDKGAFGYGSYFCLSLMDKLYHPDMTVEEAVDLVDKCIKEIRLRLVVAPQNFVIK
IVDKDGAREYARRELVGDNAPAEAATAVVAA*

MECVLGLVGRDFAVVAADTSAVQSILVHKTDEDKVMVLDSHKLLGASGEPGDRVQFTEFI
QKNLHLYQFRNTIPLSTAAAANFTRGELATALRKNPYMVNVILGGYDKDVGASLYYIDYI
ATLHKIDKGAFGYGSYFCLSLMDKLYRPDMTVEEAVDLVDKCIKEIRLRLVVAPQNFVIK
IVDKDGAREYARRELVGDSAPAEAAATVAA*

Other information
Ka divergence:-0.55896KaKs divergence:-0.549889
GC content 1 (%):53GC content 2 (%):57GC content divergence:0.036
Length 1 (bp):636Length 2 (bp):633Length divergence:-0.002
MFE 1 (kcal):-227.5MFE 2 (kcal):-240.86MFE divergence0.029