Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G097434-GRMZM5G860976
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383869
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:3.0244986673945
Log2 mRNA fold difference:2.8704840323602
Log2 TE fold difference:0.11914974729192
Sequences
Protein sequence

MEAMTGGKFLQKFRLYETRSKFYLIGRDKSRIHWRVLKIDRSEFTELGVEEDPTIYTENE
CQELLRRIHEGNRLTGGLKFVTKCYGIVGFVKFLGPYYMVIITRRRKIGTICGHEIYSVG
KSEMIAIPSVTVWPNMAYSRDENRYKHLLCSVDLSKDFFFSYSYNIMHSLQKNITEKNIG
QVYETMCVWNEFMTRAIRDHLMNTCWTVALVHGFFKQSRFSVSGKDFWLTLIARRSRHFA
GTRFLKRGVNGKGRVANDVETEQIVFEDTSGGIPTQMASVVQHRGSIPLVWFQETSRLNI
RPDIILKPDLDYKATRLHFENLALRYGNPIIILNLIKTHEKKPRESLLCAEFAKAIHYIN
KSLSDDKCLKFLHMDLSNLFRRKGTNVLALLSKVASDVLDLTEFLHCEISTSTKSDDISS
EEKTVAKPRDDRSSRDQTECAAKLVPLLLQKGVLRTNCIDCLDRTNVAQFSYGLAALGRQ
LHALGLAEAHKIELHDPLVDDLMDFYERMGDTLAIQYGGSAAHNKIFCEQRGQWKATTQS
QEFLRTLQRYYNNAYTDHEKQDAINMFLGHFQPQQGKPALWKLDSDQHYNIGRQGTLKEE
IGRSFIKRSLSDGNILLESSLPVTICNNETDNTELLPVQQLDDIREASDSAPEISICEPN
LCSSMNYGTVPGRHSMSEERQSYLKRLGYPELHSSNFFDLDLLSSSGNSFDEEVFERSLL
INSPMDVISPESSMSYSEQGHTDEGRDDTDLSRSSSQLSDIRDYSDHFAQWVVNGDTLCY
*

MEAMTGGKFLQKFRLYETRSKFYLIGRDKSRIHWRVLKIDRLESTELGVDEDPTIYTESE
CQELLWRIHEGNMLTGGLKFVTKCYGIVGFVKFLGPYYMVIITSRRKIGTICGHEIYSVG
KSEMIAISSVTVWPNVAYSRDENRYKRLLCSVDLSKDFFFSYSYNIMRSLQKNITQKNTG
QA

Other information
Ka divergence:-0.0659922KaKs divergence:-0.0173847
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2343Length 2 (bp):546Length divergence:-0.622
MFE 1 (kcal):-705.86MFE 2 (kcal):-155.6MFE divergence-0.639