Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G097573-GRMZM2G175269
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.5739842651712
Log2 mRNA fold difference:2.2614707370021
Log2 TE fold difference:-0.6743449820803
Sequences
Protein sequence

MSGASARGRLSPASSGGGDSEPRSTGGRTRSVSAARGRKPSPRPGRDVAAAAGATEEKKP
AAVLTLQPSLSAPAGMRRQELLLRSGLSLDASCSSDASTDSFCSRASTGRIGRPAFGARK
KKALSQTDYKALSMLERDGGLISQTDAAGVKRRCAWVTANTDPCYAAFHDEEWGVPVHDD
KKLFELLVLSGALAELTWPAILNKRDIFREVFMDFDPVLVSKLSEKKIIAPGSPSCSLLS
EQKLRGVIENARQILKIIEEFGSFDKYCWSFVNHKPILSRFRYSRQVPVKTSKADAISKD
LVRRGFRSVGPTVVYTFMQVSGMTNDHLISCYRFAECAASSAGAAKLSDGSLANSSDSSH
GTAEQKMNGTNGLDSGLELSRTIDELSIS*

MSGASARGRLSPASGGAGDSEPRSAGGRTRSVSATRGRKPSPRPGRDAAAAAGATEERKP
AAVPTLLPSLSAPAGMRRQELLLRSGLSLDASCSSDASTDSFCSRASTGRIGRPAFGARK
KKTLSQTDYKPVSMLEREGGLAYQTDAAGVKRRCAWVTANTDPCYSAFHDEEWGVPVHDD
RKLFELLVLSGALAELTWPAILNKRDIFREVFMDFDPVSVSKLSEKKIIAPGSPSSSLLS
EQKLRGVIENARQILKIIEEFGSFDKYCWSFVNHKPILSRFRYSRQVPVKTSKADAISKD
LVRRGFRSVGPTVVYTFMQVSGMTNDHLISCYRFAECVASSAGAAKLTDGSLADASDSNH
ATAEQKVNGTNDIELSRAIDELSIS*

www.000webhost.com

Other information
Ka divergence:0.0645161KaKs divergence:-0.127738
GC content 1 (%):54GC content 2 (%):56GC content divergence:0.018
Length 1 (bp):1170Length 2 (bp):1158Length divergence:-0.005
MFE 1 (kcal):-471.5MFE 2 (kcal):-467.6MFE divergence-0.004