Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G097728-GRMZM2G097746
Species:maize
Duplication type:TD
Function (paralog1):GTP-binding protein YPTM2
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.0631048410097
Log2 mRNA fold difference:-1.5706900824946
Log2 TE fold difference:0.43860257244671
Sequences
Protein sequence

MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQ
IWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVG
NKSDLTANKVVATETAKAFADEMGIPFMETSAKNATNVEQAFMAMAASIKDRMASQPAAA
NARPATVQIRGQPVNQKTSCCSS*

ACVDINQIFDYLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKT
IKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNK
LLVGNKSDLTANKVVATETAKAFADEMGIPFMETSAKNAINVEQAFMAMAASIKDRMASQ
PAAANARPATVQIRGQPVNQKTSCCSS*

Other information
Ka divergence:0.604534KaKs divergence:0.50135
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):612Length 2 (bp):624Length divergence:0.01
MFE 1 (kcal):-186.02MFE 2 (kcal):-187MFE divergence0.003