Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G098208-GRMZM2G148216
Species:maize
Duplication type:WGD
Function (paralog1):protein kinase CK2 regulatory subunit CK2B2
Function (paralog2):hypothetical protein LOC100274243

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.9759461966856
Log2 mRNA fold difference:-2.0106137044168
Log2 TE fold difference:0.32833319496424
Sequences
Protein sequence

MDRKRIKDALEKHLERSSPSTSRGVVSKERERLAAGKLPSSLGKAEVSDGEEFETDSEDS
DVSGSEGEDTSWISWFCTLRGNEFFCEIDDDYIQDDFNLCGLSNQVPYYDYALDLILDIE
SSNDDGFTEEQNELIESSAEMLYGLIHARYILTSKGLAAMLEKFKNYDFGRCPRVYCCGQ
PCLPAGQSDVPRSSTVKIYCPKCEELNYPRSKYQGNIDGSYFGTTFPHLFLMTYSHLKPQ
KPSQQYTPRVFGFKLHKPS*

MNRGRETGGNLRESGLFSGCDGDGGAGMDRKRIKDVLEKHLERSSPSTSRGVVSKERERL
AAGKLPASLGKAEKVSDGEEFETDSEDEDSDISGSESEGTSWISWFCTLRGNEFFCEIDD
DYIQDDFNLCGLSMQVPYYDYALDLILDIESSDDTYTEERKEFIELSAEILYGLIHARYI
LTSKGLAAMLEKFKNRDFGGCPRVYCCGQPCLPAGQSDVPRSSTVKIYCPKCEELNYPIS
MYQGSILLICSFNCFVQYDISILPFASTGHFMLFFSSDLYFDHHSKLLK*

Other information
Ka divergence:0.883671KaKs divergence:0.823242
GC content 1 (%):48GC content 2 (%):45GC content divergence:-0.032
Length 1 (bp):780Length 2 (bp):870Length divergence:0.055
MFE 1 (kcal):-261.67MFE 2 (kcal):-265.52MFE divergence0.007