Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G098517-GRMZM2G431309
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384069
Function (paralog2):LOC100281447

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.8461896811317
Log2 mRNA fold difference:0.35277523181855
Log2 TE fold difference:1.1474581154692
Sequences
Protein sequence

MADPPTSRMVQHPFGDIPSQTPKQFLYSGSSQHLCHPYQSASDAHVAPQRHYTVRSQSQS
QSPDAGSEDFETHSRQYTLDSSSASGCSGHGSPSCQSVHAGSRSPVSHSHDDSHSGSTNG
NGSPASASCVTEDPTDLKQKLKDLEAVMLGTDTDPETVDSLEIAIADRLSVEPEEWKNNM
VSVPRGDLKELLIACARAVEQNNGYSIDLMVPELRKMVSVSGEPLERLGAYMVEGLVARL
AASGSSIYKALRCKEPRSSDLLSYMHFLYEACPYFKFGYMSANGAIAEAVKGEDRIHIID
FHIAQGAQWVSLLQALAARPGGPPFVRVTGIDDPVSAYARGGGLELVGKRLSHIAGLYKV
PFQFDAVAISGSEVEEGHLGVVPGEAVAVNFTLELHHIPDETVSTANHRDRVLRLVKGLS
PRVLTLVEQESNTNTAPFAQRFAETLDYYAAIFESIDLALPRGDRERINIEQHCLAREIV
NLVACEGEERVERHEVFGKWKARLMMAGFRPSPLSALVNATIKTLLQSYSPDYKLAEREG
VLYLGWKNRPLIVSSAWH*

MADTPTSRMVHPFGDAPRQTPKQFLYSGNPQHLCHPYQSAPDTHVVLQRRYTVRSQSHSP
NNAGSEDHETHKQYTLESSAASGCSRHGSPSSQSVHAGSGSPVSHDDSHSGSTNGHGSPV
SASCVTGEDPTDLKQKLKDLEAVMLGTSETDPEIVNSLEISAANQLSLEPEEWEHMVSMP
RGNLKELLIACARAVERNNSYAIDLMITELRKMVSVSGEPLERLGAYMVEGLVARLAASG
SSIYKALKCKEPRSSDLLSYMHFLYEACPYFKFGYMSANGAIAEAIKGEDRIHIIDFHIA
QGAQWVSLLQALAARPGGPPFVRVTGIDDSVSAYARGGGLELVGRRLTHIAGLYKVPFQF
DAVAISGSEVEEEHLGVVPGEAVAVNFTLELHHIPDETVSTANHRDRILRLVKGLSPKVL
TLVEQESNTNTAPFAQRFAETLDYYTAIFESIDLALPRDDRERINIEQHCLAREIVNLVA
CEGEERVERHEVFGKWKARLMMAGFSPSPLSALVNATIKTLLQSYSPDYKLAERDGVLYL
GWKNRPLIVSSAWH*

Other information
Ka divergence:-0.33668KaKs divergence:0.162452
GC content 1 (%):62GC content 2 (%):60GC content divergence:-0.016
Length 1 (bp):1677Length 2 (bp):1665Length divergence:-0.004
MFE 1 (kcal):-742.52MFE 2 (kcal):-707.38MFE divergence-0.024