Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G098520-GRMZM2G113033
Species:maize
Duplication type:WGD
Function (paralog1):Ribulose bisphosphate carboxylase small chain, chloroplastic Precursor (RuBisCO small subunit)(EC 4.1.1.39)
Function (paralog2):hypothetical protein LOC100279574

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.60741371086644
Log2 mRNA fold difference:0.97121699985566
Log2 TE fold difference:-0.36503547399948
Sequences
Protein sequence

MAPTVMMASSATAVAPFQGLKSTASLPVARRSSRSLGNVSNGGRIRCMQVWPAYGNKKFE
TLSYLPPLSTDDLLKQVDYLLRNGWIPCLEFSKVGFVYRENSTSPCYYDGRYWTMWKLPM
FGCNDATQVYKELQEAIKSYPDAFHRVIGFDNIKQTQCVSFIAYKPPGSD*

MAPTVMMASSATAVAPFQGLKSAASLPVARRSTRSLGNVSNGGRIRCMQVWPAYGNKKFE
TLSYLPPLSTDDLLKQVDYLLRNGWIPCLEFSKLGFVYRENSTSPCYYDGRYWTMWKLPM
FGCTDATQVYKELQEAIAAYPDAFHRVIGFDNVRQTQCVSFIAYKPPGSE*

Other information
Ka divergence:0.0639294KaKs divergence:-0.200261
GC content 1 (%):64GC content 2 (%):66GC content divergence:0.015
Length 1 (bp):513Length 2 (bp):513Length divergence:0
MFE 1 (kcal):-200.44MFE 2 (kcal):-207.9MFE divergence0.018