Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G099049-GRMZM2G005146
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383843 (LOC100383843), mRNA
Function (paralog2):auxin-repressed protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGLLDQLWDDTVAGPRPDSGLGKLRKHASFSPSSAAPSPTAEGAAPPAVTRSITMLRPAA
LSVATSPRSESSSAPSSPSPASGAPDSPFGAGDHQLSPSPSLLFFPPVLVVAARCLTVSL
ELAEGIFGSVSVVKSKKKKRKEIYGIWLIISQLHASF*

MGLLNQLWDDTVAGPRPDSGLGKLRKYASFSPSSSSSAAVAAAAAAGSAPPPGAVTRSLT
MLRRPAALSVVTSPRSESSSAPSSPSPASGAPDSPFGAATTPRGEGWTKKLRGKARMGGG
GGDDAPGTPRSPTVYDWVVISSLDL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):64GC content 2 (%):75GC content divergence:0.079
Length 1 (bp):474Length 2 (bp):438Length divergence:-0.039
MFE 1 (kcal):-201.72MFE 2 (kcal):-247.2MFE divergence0.101