Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G099186-GRMZM2G099317
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100193414
Function (paralog2):hypothetical protein LOC100272956

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.66990869510704
Log2 mRNA fold difference:-1.0852854668811
Log2 TE fold difference:0.41420059047419
Sequences
Protein sequence

MPRYDDRHGNTRLYVGRLAPRTRSRDLEYLFSKYGRIREVELKRDYAFIEFSDPRDADDA
QYNLDGREVDGSRIIVEFAKGVPRGSGGSREYMGRGPPPGTGRCFNCGMDGHWARDCKAG
DWKNKCYRCGESGHIERNCQNSPRNLRRDKSYSRSPSPRGGRGRSRSYSRSRSYSRSRSP
SGSPRGGRRERDERRSRSLSYSRSASPRRSVSPAKEKERSRTPNGSRSPRSPSPRAEVSP
PLKDNGARNGSDHEGNPGGGENSKRSRSPSDGYRSPVANGRSPSPRDDRSPSPKGNNEDD
ERRGSPRGSQSPLN*

MPRYDDRYGGTRLYVGRLAPRTRSRDLEYLFGKYGRIREVELKRDYAFIEFSEHRDADEA
RYQLDGRDVDGSRIVVEFAKGVPRGPGGSREYMGRGPPPGTGRCFNCGMDGHWARDCKAG
DWKNKCYRCGERGHIERNCQNSPRSVRRERSYSRSPSPRRGRGRSPSYSRSRSRSRSRSY
SRSRSLSGSPRGGRRDRDDRRSRSLSYSRSPMRSPPAKEKERSPTPGGSRSPRSRSPQDQ
VMSPPPKDNGDRNGSDRGDSPRGRENSRSRSRSRSPSGGNRSPAANGRSPSPRGDRTPSP
MADRSPSPKGNGNNDGGDDDTGRGGSPTGSKSP*

www.000webhost.com

Other information
Ka divergence:-0.250619KaKs divergence:-0.555339
GC content 1 (%):55GC content 2 (%):56GC content divergence:0.009
Length 1 (bp):945Length 2 (bp):1002Length divergence:0.029
MFE 1 (kcal):-335.41MFE 2 (kcal):-363.65MFE divergence0.04