Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G099255-GRMZM2G114337
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100276287

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.11148603723689
Log2 mRNA fold difference:-1.1988158748554
Log2 TE fold difference:1.2492998393405
Sequences
Protein sequence

MAPRSRAPSRRPLWFIVLVAFVCVVAIGAYLYTPQHYTACYLVPSEACNSRPPPEPARVY
TDDEIAARVIMRDIIRARPVQSKNTKIAFMFLTPSLLPFEKLWEKFFMGHEDRYTIYVHA
SRDIPSHSSPIFAGRDIRSEKVIWGTISMLDAEKRLLAHALQDPENQHFVLLSESCVPLH
NFDYIYSYLMETNVSFVDCFDDPGPHGAGRYSEHMLPEIVKKDWRKGAQWFTVKRQHAIL
ILADTLYYGKFKRYCKPGNEWHNCYSDEHYLPTLFNMVDPTGISNWSVTHVDWSEGKWHP
KVYRAADTSFDLLKDIASIDESVHVSSNAKHVAQRRPCVWNGMKRPCYLFARKFYPEALD
NLLNIFSNFTII*

MAPRSRPSSKRPLWFIVLVAFVCAVAIGAYLYTPRHYTACYLVPSEACNSRPPPEPARVY
TDDEIAARAIMRDIIRARPVQSKNPKIAFMFLTPSSLPFEKLWEKFFMGHEDRYTIYVHA
SRDRPIHASPVFSGRDIRSEKVIWGTISMVDAEKRLLAHALQDPENQHFVLLSESCVCVP
LHNFDYIYSYLMETNVSFVDCFDDPGPHGAGRYSDHMLPEIVKKDWRKGAQWFTVKRQHA
VLILADTLYYGKFKRYCKPGNEWHNCYSDEHYLPTLFNMADPTGIANWSVTHVDWSEGKW
HPKVYRAVDTSFELLKNISSIDESVHVSSNAKHVAQRRPCVWNGMKRPCYLFARKFYPEA
LGNLMNIFSNFTVI*

Other information
Ka divergence:-0.112639KaKs divergence:-0.999869
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1119Length 2 (bp):1125Length divergence:0.003
MFE 1 (kcal):-362.1MFE 2 (kcal):-378.3MFE divergence0.022