Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G099352-GRMZM2G074300
Species:maize
Duplication type:WGD
Function (paralog1):LOC100282772
Function (paralog2):hypothetical protein LOC100274348

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MATQISKKKKFVSDGVFYAELNEMLTRELAEDGYSGVEVRVTPMRTEIIIRATRTQNVLG
EKGRRIRELTSVVQKRFNFPENGVELYAEKVVNRGLCAIAQAESLRYKLLGGLAVRRACY
GVLRYVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVNEYIDSAVRHVLLRQG
VLGIKVKIMLDWDPKGKVGPITPLPDLVTIHTPKDEDEPRPPVLAPPEV*

MATQISKKKKFVSDGVFYAELNEMLTRELAEDGYSGVEVRVTPMRTEIIIRATRTQNVLG
EKGRRIRELTSVVQKRFNFPENGVELYAEKVVNRGLCAIAQAESLRYKLLGGLAVRRACY
GVLRFVMESGAKGCEVIVSGKLRAQRAKSMKFKDGYMISSGQPVNEYIDSAVRHVLLRQV
CFATIARCNVCLSLGKHFIFDVPNVISQQTSFSVVQGVLGIKVKIMLDWDPKGKVGPITP
LPDLVTIHTPKEEDELRPPVLAAEV*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):58GC content 2 (%):56GC content divergence:-0.018
Length 1 (bp):690Length 2 (bp):798Length divergence:0.073
MFE 1 (kcal):-293.5MFE 2 (kcal):-317.8MFE divergence0.04