Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G099355-GRMZM2G433801
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.0619123768237
Log2 mRNA fold difference:-2.3816795459273
Log2 TE fold difference:0.31736817222897
Sequences
Protein sequence

MWNGAPPPPPPQMAAAPPPPGTTVPGAGQPPPPPPPAGAPLGGKPLTPAELEAQLVEKAR
KWHQLNSKRYGDKRKFGFVEAQKEDMPPEHVRKIIRDHGDMSSKKYRHDKRVYLGALKFV
PHAVYKLLENMPMPWEQVRHVKILYHITGAITFINEIPWVVEPIYLAQWGTMWIMMRREK
RDRRHFKRMRFPPFDDEEPPLDYADNLLDVEPLEAIQLELDEEEDAAVYEWFYDHKPLMK
TKLINGPSYRKWHLSLPIMATLYRLAGQLLSDLIDRNYFYLFDMESFFTAKALNMCIPGG
PKFEPLYRDMEKGDEDWNEFNDINKLIIRQPLRTEYRIAFPHLYNNRPRKVKLGIYHTPM
IMYIKTEDPDLPAFYYDPLINPITSTNKVDRRERKAAEEEDDEDFCLPEDVEPLLKQTEL
YTDTTAAGISLLFAPKPFNMRSGRTRRAEDIPLVSEWFKEHCPPAYPVKVRVSYQKLLKC
YVLNELHHRPPKAQKKKHLFRSLQATKFFQTTELDWAEAGLQVCKQGYNMLNLLIHRKNL
NYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREILRLTKLVVDANIQFRLGNVDAFQ
LADGLQYIFSHVGQLTGMYRYKYRLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPM
WRVWLFFLRGIVPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDV
LDAMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPVPIENMILRYVKSKADWWTNV
AHYNRERIRRGATVDKTVCRKNLGRLTRLWLKAEQERQHNYLKDGPYVTPEEAVAIYTTT
VHWLESRKFSPIPFPPLSYKHDTKLLILALERLKESYSVAVRLNQLQREELGLIEQAYDN
PHEALSRIKRHLLTQRAFKEVGIEFMDLYSYLIPVYEIEPLEKITDAYLDQYLWYEGDKR
HLFPNWVKPADSEPPPLLVYKWCQGINNLLDIWDTSDGQCVVMLQTKFEKFFEKIDLTLL
NRLLRLVLDHNIADYVTAKNNVVLSYKDMSHTNSYGLIRGLQFASFVVQYYGLVLDLLIL
GLTRASEIAGPPQMPNEFLTYADTKVETRHPIRLYSRYIDKVHILFRFTHEEARDLIQRY
LTEHPDPNNENMVGYNNKKCWPRDARMRLMKHDVNLGRSVFWDMKNRLPRSITTLEWENS
FVSVYSKDNPNLLFSMSGFEVRILPKIRMTQEAFSNTKDGVWNLQNEQTKERTAIAFLRV
DDEHMKVFENRVRQILMSSGSTTFTKIVNKWNTALIGLMTYFREATVHTQELLDLLVKCE
NKIQTRIKIGLNSKMPSRFPPVIFYTPKEIGGLGMLSMGHILIPQSDLRYSKQTDVGVTH
FRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAQSQNRRLTLEDLEDSW
DRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRT
DVIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNR
RFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESVVMD
LCQVLDQELDALEIETVQKETIHPRKSYKMNSSCADILLFAAHRWQMSKPSLVSESKDVF
DQKASNKYWIDVQLRWGDYDSHDIERYTRAKFMDYTTDNMSIYPSPTGVMIGIDLAYNLH
SAFGNWFPGSKPLLQQAMNKIMKSNPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGEIF
SNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKVIHTSVWAGQKR
LGQLAKWKTAEEVAALVRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLP
FQACLKIEKFGDLILKATEPQMVLYNIYDDWLKSISSYTAFSRIVLILRALHVNNEKAKM
LLKPDKTIVTEPHHIWPSLNDEQWLKVECALRDLILSDYAKKNNVNTSALTQSEMRDIIL
GAEIAPPSQQRQQIAEIEKQSRETTQLTAVTTRTTNVHGDELIITTTSPYEQQAFASKTD
WRVRAISATNLYLRVNHIYVNSDDIKETGYTYIMPKNILKKFICVADLRTQIAGFLYGLS
PQDNPQVKEIRCIAIPPQHGTHQMVTLPSNLPEHEFLNDLEPLGWMHTQPNEAPQLSPQD
LTSHAKILENNKQWDGEKCIILTCSFTPGSCSLTAYKLTPSGYEWGRSNKDNGSNPHGYL
PTHYEKVQMLLSDRFLGFYMIPDNTPWNFNFMGVKHDPQMKYNMKLGMPRDFYHEDHRPT
HFLEFSNIEEGEVAEGDREDTFT*

MWNGVPPPPPPPLQMAAAPPPPGTTVPGAGQPPPPPPPPAGASQGGKPLTPMELEAQLVE
KARKWHQLNSKRYGDKRKFGFVEAQKEDMPPEHVRKITRDHGDMTSKKYRHDKRVYLGAL
KFVPHAVYKLLENMPMPWEQVRHVKILYHITGAITFVNEIPWVVEPIYLAQWGTMWIMMR
REKRDRRHFKRMRFPPFDDEEPPLDYADNLLDVEPLEAIQLELDEEEDAAVYEWFYDHKP
LMKTKLINGPSYRKWHLSLPIMATLYRLAGQLLSDLIDRNYFYLFDMESFFTAKALNMCI
PGGPKFEPLYRDMEKGDEDWNEFNDINKLIIRQPLRTEYRIAFPHLYNNRPRKVKLGIYH
TPMIMYIKTEDPDLPAFYYDPLINPITSTNKVDRRERKAAEEEDDEDFCLPEDVEPLLKQ
TELYTDTTAAGISLLFAPKPFNMRSGRTRRAEDIPLVSEWYKEHCPPAYPVKVRVSYQKL
LKCYVLNELHHRPPKAQKKKHLFRSLQATKFFQTTELDWAEAGLQVCKQGYNMLNLLIHR
KNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREILRLTKLVVDANIQFRLGNVD
AFQLADGLQYIFSHVGQLTGMYRYKYRLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFW
APMWRVWLFFLRGIVPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVM
HDVLDAMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPVPIENMILRYVKSKADWW
TNVAHYNRERIRRGATVDKTVCRKNLGRLTRLWLKAEQERQHNYLKDGPYVTPEEAVAIY
TTTVHWLESRKFSPIPFPPLSYKHDTKLLILALERLKESYSVAVRLNQLQREELGLIEQA
YDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSYLIPVYEIEPLEKITDAYLDQYLWYEG
DKRHLFPNWVKPADSEPPPLLVYKWCQGINNLLDIWDTSDGQCVVMLQTKFEKFFEKIDL
TLLNRLLRLVLDHNIADYVTAKNNVVLSYKDMSHTNSYGLIRGLQFASFVVQYYGLVLDL
LILGLTRASEIAGPPQMPNEFLTYADTKVETRHPIRLYSRYIDKVHILFRFTHEEARDLI
QRYLTEHPDPNNENMVGYNNKKCWPRDARMRLMKHDVNLGRSVFWDMKNRLPRSITTLEW
ENNFVSVYSKDNPNLLFSMCGFEVRILPKIRMTQEAFSNTKDGVWNLQNEQTKERTAIAF
LRVDDEHMKVFENRVRQILMSSGSTTFTKIVNKWNTALIGLMTYFREATVHTQELLDLLV
KCENKIQTRIKIGLNSKMPSRFPPVIFYTPKEIGGLGMLSMGHILIPQSDLRYSKQTDVG
VTHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAQSQNRRLTLEDLE
DSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNN
YRTDVIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQI
PNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESV
VMDLCQVLDQELDALEIETVQKETIHPRKSYKMNSSCADILLFAAHRWTMSKPSLVSESK
DVFDQKASNKYWIDVQLRWGDYDSHDVERYTRAKFMDYTTDNMSIYPSPTGVMIGIDLAY
NLHSAFGNWFPGSKPLLQQAMNKIMKSNPALYVLRERIRKGLQLYSSEPTEPYLSSQNYG
EIFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKVIHTSVWAG
QKRLGQLAKWKTAEEVAALVRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSEL
QLPFQACLKIEKFGDLILKATEPQMVLYNIYDDWLKSISSYTAFSRIVLILRALHVNNEK
AKMLLKPDKTIVTEPHHIWPTLNDEQWLKVECALRDLILSDYAKKNNVNTSALTQSEMRD
IILGAEIAPPSQQRQQIAEIEKQSRETTQLTAVTTRTTNVHGDELIITTTSPYEQQAFAS
KTDWRVRAISATNLYLRVNHIYVNSDDIKETGYTYIMPKNILKKFICIADLRTQIAGFLY
GLSPQDNPQVKEIRCIAMPPQHGTHQMVTLPANLPEHEFLNDLEPLGWMHTQPNEAPQLS
PQDLTSHAKILENNKQWDGEKCIILTCSFTPGSCSLTAYKLTPSGYEWGRSNKDNGSNPH
GYLPTHYEKVQMLLSDRFLGFYMVPDNAPWNFNFMGVKHDPQMKYNMKLGMPRDFYHEDH
RPTHFLEFSNIEEGEAAEGDREDTFT*

Other information
Ka divergence:0.269036KaKs divergence:0.245033
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):7092Length 2 (bp):7101Length divergence:0.001
MFE 1 (kcal):-2231.63MFE 2 (kcal):-2273.15MFE divergence0.009