Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G099363-GRMZM2G127948
Species:maize
Duplication type:WGD
Function (paralog1):Caffeoyl-CoA O-methyltransferase 2 (EC 2.1.1.104)(Trans-caffeoyl-CoA 3-O-methyltransferase 2)(CCoAOMT-2)(CCoAMT-2)
Function (paralog2):Caffeoyl-CoA O-methyltransferase 1 (EC 2.1.1.104)(Trans-caffeoyl-CoA 3-O-methyltransferase 1)(CCoAOMT-1)(CCoAMT-1)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MATTATEAAKAAPAQEQQANGNGNGEQKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPE
SMKELREITAKHPWYVPLAFRPVVRGGFECVGLLDVDRPRSENERGVACRNLMTTSADEG
QFLNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAG
VGHKIDFREGPALPVLDDLVADKEQHGSFDFAFVDADKDNYLSYHERLLKLVRPGGLIGY
DNTLWNGSVVLPDDAPMRKYIRFYRDFVLALNSALAADDRVEICQLPVGDGVTLCRRVK*

MATTATEAAPAQEQQANGNGEQKTRHSEVGHKSLLKSDDLYQYILDTSVYPREPESMKEL
REITAKHPWNLMTTSADEGQFLNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILA
MDINRENYELGLPCIEKAGVAHKIDFREGPALPVLDDLIAEEKNHGSFDFVFVDADKDNY
LNYHERLLKLVKLGGLIGYDNTLWNGSVVLPDDAPMRKYIRFYRDFVLVLNKALAADDRV
EICQLPVGDGVTLCRRVK*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):65GC content 2 (%):65GC content divergence:0
Length 1 (bp):900Length 2 (bp):777Length divergence:-0.073
MFE 1 (kcal):-386.17MFE 2 (kcal):-324.6MFE divergence-0.087