Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G099452-GRMZM2G114394
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274487
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.21905918713254
Log2 mRNA fold difference:-0.35739768290018
Log2 TE fold difference:0.55602152931014
Sequences
Protein sequence

MWRIKLACLLLIFVQVQRVVLGTHDVYIVVMEGDPVVSYRGGVDGFPATAVDLDEEMDVT
SEAVTSYALHLRGHHDKLLDSHLVEGTYEKLYSYHHLINGFAVHMSSLQAEFLRKAPGVK
HVERDMKVQKLTTHTPQFLGLPTGVWPTGGGLDRAGEDVVIGFVDSGIYPQHPSFAAHKT
DRYGPVPRYKGKCEKDLVTQRSFCNGKIVGAQHFAKAAMAAGAFNPDVEFASPLDGDGHG
SHTAAIAAGNNGIPVRMHGHEFGKASGMAPRARVAVYKVLYRLFGGYVADVVAAIDQAVQ
DGVDILNLSVGPNSPPTATRTTFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKTLVSFSP
WITTVAAGVDDRRYKNHLTLGNGKLISGLGVSPATHGNMSFSLISAADALLGSSASKYSA
LDCQRPELLNKRKVQGKILLCGYSFNYISGTASIKKVSQTARSLGAAGFVVAVENSYPGT
KFDPVPVSIPGILITDVSKTEDLIDYYNSSTVRDWAGRATAFKATAGIADGLAPTLYNSA
PQVALFSSRGPDVKDFSFQDADVLKPDILAPGNLIWAAWAPNGTDESNYAGEGFAMVSGT
SMAAPHIAGIAALIKQKNPKWSPSAIKSALMTTANTLDKGSHPLRAQQYTASEMMTLSRA
TPFDCGSGAVNPKGALDPGLVLDASHEDYITFLCSIPDVNQSEVSNIAGSACNSNSKGQR
PFDLNIPSIAVSQLRGTVVVKRTVTSVSDETETYTIMTRMPPEVALEVTPPAVTVVPGAS
REITVTLTARSVTGTYSFGEIAMKGDRGHLVRIPVVAMGFK*

MRRIRLACLLVIFVQVQWAALGTHDVYIVTMEGDPVVSYRGGVQGFPATAVDSDEEIDLT
SEAVKSYALHLRGHHDKLLDSLLVEGTYEKLYSYHHLINGFAVHMSPLQAEFLKKAPGVK
HVERDMKVQKLTTHTPQFLGLPTGVWSTGGGLDRAGEDVVIGFVDSGIYPEHPSFAAHKT
DPYGPAPRYKGKCEMDPVTQRSFCNGKIVGAQHFAKAAMAAGAFNPDVEFASPLDGDGHG
SHTAAIAAGNNGVPVRMHGHEFGKASGMAPRARVAVYKVLYRLFGGYIADVVAAIDQAVQ
DGVDILNLSVGPNSPPTATRTTFLNPFDAALLSAVKAGVFVAQAAGNGGPFPKTLVSFSP
WITTVAAGVDDRRYKNHLTLGNGKLLSGLGVSPATHGNMSFSLISAADALLGSSATKYSA
LDCQRPELLNKRKVQGRILLCGYSFNYISGTASIKKVSQTARNLGAAGFVVAVENNYPGT
KFDPVPFSIPGILITDVSKTEDLIDYYNSSTIRDWAGRATAFKATAGIADGLAPTLYNSA
PQVALFSSRGPDVKDFSFQDADVLKPDILAPGNLIWAAWAPNGTDESNYAGEGFAMVSGT
SMAAPHIAGIAALIKQKNPKWSPSAIKSAMMTTANTLDKGSRPLRAQQYTASEMMTLSRA
TPFDCGSGAVNPKAALDPGLVLDATHEEYIAFLCSIPDVNQSEVSNIAGSACNSSSKGRQ
RPFDLNLPSIAISQLRGTVTVTRTVTSVSEETETYTIMTRMPPEVALEVTPPAVTVLPGA
SRELAVTLTARSVTGTYSFGEIAMKGDRGHLVRIPVVAMGFK*

Other information
Ka divergence:0.288675KaKs divergence:0.168289
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):2466Length 2 (bp):2469Length divergence:0.001
MFE 1 (kcal):-852.44MFE 2 (kcal):-872.5MFE divergence0.012