Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G099598-GRMZM2G127050
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273485 (LOC100273485), mRNA
Function (paralog2):ATP binding protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.035873306270036
Log2 mRNA fold difference:-0.074218209374736
Log2 TE fold difference:0.13595016055487
Sequences
Protein sequence

MGCCGSSQRAGTHPEKKPPGALPPHRPSYSLNQHQAPAPPPPSAARAGARQVPPLKEFSL
AELRAATAGFAAGNIVSESGEKAPNFVYRGRLDAGRRAIAVKKFTKMAWPDPKQFAEEAK
GVGKLRHCRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHWENQTIEWAMRLRVAYYIA
EALEYCSTEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLR
NGRVTSESVIFSFGTILLDLLSGKRIPPSRALDMIKGNNIQVLMDSHLEGNYSTDEATTL
VDLASQCLQYEPRDRANTKKLVSVLEPLQIKSEVPSYEMLGIPKHEEEAPPPPQPQRPLS
PMGEACSRTDLTAIHQILVNTHYRDDEGSNELSFQEWTQQMRDMLEARKRGDFAFRDKDF
KAAIDCYTQFVDVGTMVSPTVYARRSLCHLMCDQPDAALRDAMQAQCVYPDWPTAFYMQA
VALAKLNMQSDATDMLNEASQLEEKRQKNTKP*

MGCCGSSLRAGTQPEKKPAAGALPPRRPSYSLSQNQNQAPPAARAGAHQVPPLREFSLAE
LRAATAGFAPDNIVSESGDKAPNFVYRGRLEPSRRAIAVKKFAKMAWPDPKQFAEEAKGV
GKLRHRRLANLIGYCCDGEERLLVAEFMPNDTLAKHLFHWENQTIEWAMRLRVAYYIAEA
LEYCSTEGRPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYTPPEYLRNG
RVTSESVIFSFGTILLDLLSGKRIPPSRALDMIKGNNIQVLMDSHLEGNYSTEEATTLVD
LASQCLQYEPRDRPNTKKLVSVLEPLQIKSEVPSYEMLGIPKHEEEAPPPPQPQHPLSPM
GEACSRMDLTAIHQILVNTHYRDDEGSNELSFQEWTQQMRDMLEARKRGDFAFRDKDFKA
AIDCYTQFVDVGTMVSPTVYARRSLCHLMCDQPDAALRDAMQAQCAYPDWPTAFYMQAVA
LSKLNMQSDATDMLNEASQLEEKRQKNTKP*

Other information
Ka divergence:0.178436KaKs divergence:0.0763171
GC content 1 (%):57GC content 2 (%):57GC content divergence:0
Length 1 (bp):1539Length 2 (bp):1533Length divergence:-0.002
MFE 1 (kcal):-608.3MFE 2 (kcal):-590.34MFE divergence-0.015