Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G099628-GRMZM2G143450
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.38775657236205
Log2 mRNA fold difference:-0.21152722059873
Log2 TE fold difference:-0.16572548242637
Sequences
Protein sequence

MASSPPPPKLPIPGRRNILITSALPYVNNVPHLGNIIGCVLSADVFARYCRLRGYNAIYI
CGTDEYGTATETKAMEEKCTPKEICDKYHAIHNEVYKWFNIKFDKFGRTSSPEQTEICHA
IFHKLMENNWLTENTMQQLYCDMCQKFLADRLVEGTCPNKVCNASARGDQCETCSTLLNP
TELIDPKCKVCKNTPRIRDTDHLFLELPLLRDKLVNYINETSVAGLWSQNAIQATNAWLK
EGLKPRCITRDLKWGVPVPHEKYKDKVFYVWFDAPIGYVSITASYTPEWEKWWKNPDNVE
LFQFMGKDNVPFHTIMFPSTLLGTGEKWTMMKTISVTEYLNYEAGKFSKSKGIGVFGNDA
KDTNIPPEVWRYYLLMNRPEVSDTLFTWADLQAKLNSELLNNLGNFINRVLSFIAKEAGA
GYDSVVPDAPNAGEHTLTKILAEKTSKWVEQYLDAMEKVKLKQGLKSAMGISSDGNAYLQ
ESQFWKLYKEDPAACAIVMKTSVGLVYLLACLLSPFMPSFSDEVLRQLNLSPEENLSLSE
EKGEIAKAKSPWDFVPAGHRIGKPAPLFKELKDEDVALHREKYAGSQAERSSKAAADAEA
NKVANQLKGTKLSDGGTKKGPKKQSGGSKSKTADADITVAKLDIRVGLIRKAEKHPDADS
LYVEEIDVGEDTPRTVVSGLVKFIPLEEMQQNRKVCVLCNLKPVAMRGIKSHAMVLAASN
EDHTKVELVEPPESAAVGERVTFAGYSGEPEASLSGKSKTWEKLAAELHSNGELVACYKD
VPFTTSAGICKVKTIANGEIR*

MASSSSPPPPKLPIPGRRNILITSALPYVNNVPHLGNIIGCVLSADVFARYCRLRGYNAI
YICGTDEYGTATETKAMEEKCTPKEICDKYHAIHNEVYKWFNIKFDKFGRTSSPEQTEVC
HAIFHKLMENNWLTENTMQQLYCDTCQKFLADRLVEGTCPNKVCNASARGDQCETCSTLL
NPTELIDPKCKVCKNTPRIRDTDHLFLELPLLRDKLVNYINETSVAGLWSQNAIQATNAW
LKEGLKPRCITRDLKWGVPVPHEKYKDKVFYVWFDAPIGYVSITASYTPEWEKWWKNPDN
VELFQFMGKDNVPFHTIMFPSTLLGTGEKWTMMKTISVTEYLNYEAGKFSKSKGIGVFGN
DAKDTNIPPEVWRYYLLMNRPEASDTLFTWADLQAKLNSELLNNLGNFINRVLSFVAKPA
GAGYGSVVPDAPNAGAHTLTKTLAEKTSKWVEQYLDAMEKVKLKQGLKSAMGISSDGNAY
LQESQFWKLYKEDPAACAIVMKTSVGLVYLLACLLEPFMPSFSDEVLRQLNLSPEENLSL
SEEKGEIAKAKTPWNFVPAGHRIGKPAPLFKELKDEDVALHREKYAGSQAERSSKAAADA
EANKVANQLKGTKLSDGGTKKEPKKQSGGSKSKTAEADITVAKLDIRVGLIRKAEKHPDA
DSLYVEEIDVGEDAPRTVVSGLVKFIPLEEMQSRKVCVLCNLKPVAMRGIKSHAMVLAAS
NEDHTKVELVEPPESAAVGERVTFAGYAGEPEASLSGKSKTWEKLAAELHSNGELVACYR
DVPFTTSAGVCRVKTIANGEIR*

Other information
Ka divergence:-0.143678KaKs divergence:-0.557349
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):2406Length 2 (bp):2409Length divergence:0.001
MFE 1 (kcal):-754.68MFE 2 (kcal):-775.15MFE divergence0.013