Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G099745-GRMZM2G162788
Species:maize
Duplication type:WGD
Function (paralog1):LOC100280613
Function (paralog2):LOC541680

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MLMIQLPQTDSLSYSTKPETRRRVGTDKTLSHLPRTPGLRGWNLMLQSQARCVSLFELHL
MTSEHHFHLLKTYDLFNSIINCVLVLAEEMVLLCDSQPYAILRKTTACVLEILSL*

MAEESGRPLPKFGEWDVNDPASADGFTVIFNKARDEKKGGNGQDTDSPSKDPRTERVESY
AAKPSTKKWFCCVTASPTQS*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):45GC content 2 (%):51GC content divergence:0.063
Length 1 (bp):348Length 2 (bp):243Length divergence:-0.178
MFE 1 (kcal):-90.1MFE 2 (kcal):-83.3MFE divergence-0.039