Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G099754-GRMZM2G007283
Species:maize
Duplication type:WGD
Function (paralog1):serine/threonine-protein kinase NAK
Function (paralog2):hypothetical protein LOC100272762

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRGWATPGTSRRKNPSNRATGRRRRWATAAHGRRMPSSLRTRKPSKNANADRKHTCMSSD
ISDPSTPRKVEDAKNISIYNDVIAFTLFELETITKSFRVDYVLGEGGFGTVYKGYIDENV
RVGLKSLPVAVKVLNKDGHQGHREWLTEVNCLGQLRHPNLVKLIGYCCEDDHRLLVYEFM
FRGSLENHLFRKTATPLPWGTRMSIALGAAKGLACLHNAQRPVIYRDFKTSNILLDSDYT
AKLSDFGLAKDGPEGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTG
RKSIDKSRPSREQSLVDWALPKLNDKRRLLQIIDPRLEGQYSARAAHKSCSLAFYCLSQN
PKARPLMSDVVETLAPLQQGGGGGSDASSGLPDCRGRRRLTGNSVVHFRAIPNPKCTPVV
PACRVR*

MGNCGTREENAVVAAHAQVQQLHLLQNPAKNAIGDRKHNRTSSDISDPSTPRKAEDAKNI
SIYNDVIVFTLFELETITKSFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNK
DGHQGHREWLTEVNCLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTATP
LPWGTRMSIALGAAKGLACLHNAQRPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPEGD
QTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSIDKSRPSREQSLV
DWALPKLNDKRRLLQIIDPRLEGQYSARAAHKACSLAFYCLSQNPKARPLMSDVVETLEP
LQGSGGGDGRGQPSGLPDYRGRRRITGNSVHFRAIPNPKCSPAVPATACRVR*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):56GC content 2 (%):54GC content divergence:-0.018
Length 1 (bp):1281Length 2 (bp):1239Length divergence:-0.017
MFE 1 (kcal):-489.09MFE 2 (kcal):-453.3MFE divergence-0.038