Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G099797-GRMZM2G126834
Species:maize
Duplication type:WGD
Function (paralog1):response regulator 8
Function (paralog2):response regulator 10

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.1416119964227
Log2 mRNA fold difference:-0.843731150009
Log2 TE fold difference:-0.29630492778867
Sequences
Protein sequence

MAAAEARGADFPVGMKVLVVDDDPTCLVVLKRMLLECRYDVTTCPQATRALTMLRENRRG
FDVIISDVHMPDMDGFRLLELVGLEMDLPVIMMSADSRTDIVMKGIKHGACDYLIKPVRM
EELKNIWQHVVRKKFNGNKDHEHSGSLDDTDRNRPTNNDNEYASSANDGGDGSWKSQKKK
REKEDDETDLESGDPSTSKKPRVVWSVELHQQFVNAVNHLGIDKAVPKKILELMNVPGLT
RENVASHLQKFRLYLKRIAQHHAGIPHPFVASASSAKVAPLGGLEFQALAASGQIPPQAL
AALQDELLGRPTSSLALPGRDQSSLRLAAIKGNKPHGEREIAFGQPIYKCQNNTYGAFSQ
SSPAVGGLPSFAAWPNNKLGMTDSSNTLGNVGNSQNSNMLLHELQQQPDTLLSGTLHNID
VKPSGVVMPSQSLNVFPASEGISHNQNPLVIPSQSPSFLASVPPSMKHESLLGSPSPSTS
LLGGLDMVNQASTSQPLISSHGANLPGLMNRSSNAMPSPGISNFQSGNIPYVVTQNAMGV
SSRPPGVLKTECTESLTHSYGYIGGSTSVDSSLLSSQAKNPQYGLLQSQNDVSSSWLSSQ
DFDSFGNSLGQGHPGSTSSSFQSSALGKLPDQGRGRNHGFVGKGTCIPSRFAVDEVGSPT
NLSHNIVNSGDIVNPDIFGFSGQM*

MAAAKARGGEFPVGMKVLVVDDDPTCLVVLKRMLLECRYDVTTCPQATRALTMLRENRRG
FDVIISDVHMPDMDGFRLLELVGLEMDLPVIMMSADSRTDIVMNGIKHGACDYLIKPVRM
EELKNIWQHVIRKKFNENKDHEHSGSLDDTDRNRPTNNDNEYASSANDGGDGSWKSQRKK
REKEDDETDLENGDPSSTSKKPRVVWSVELHQQFVNAVNHLGIDKAVPKKILELMNVPGL
TRENVASHLQKFRLYLKRIAQHHAGIPHPFVAPVSSANVAPLGGLEFQALAASGQIPPQA
LAALQDELLGRPTSSLALPGRDQSSLRVAAIKGNKHHEEREIAFGQPIYKCQNNAYGAFP
QNSPAVGGLQPFAAWPNNKVGMTDSTSTLGNVGNSQNSNMLLHELQQQPDTLLLGTLHNI
DAKPSGVVMPSQSLNTFPASEGISPNQNPLIIPSQPPSFVSSIPPSMKHESLLGLPSTST
SLLGGLDMVNQASTSQALISSHGTNLPGLMNRSSNAIPSPGISNFQSGNIHYVVNQNAMG
VSSKPPGVLKTESTDSLSCSYGYIGGSTSVDSGLFSSQSKNPQYDLLQNQNDVNGSWSPS
QDFDSFGNSLGQGHPGTTSSNFQSSALGKLPDQGRGRNHGFVGKGTCIPSRFAVDEVESP
TNNLSHSIGNSGDIVNPDIFGFSGHM*

Other information
Ka divergence:0.235519KaKs divergence:0.25102
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):2055Length 2 (bp):2061Length divergence:0.001
MFE 1 (kcal):-660.12MFE 2 (kcal):-640.36MFE divergence-0.015