Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G100090-GRMZM2G425965
Species:maize
Duplication type:WGD
Function (paralog1):ubiquitin-protein ligase
Function (paralog2):LOC100281122

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.62372993720089
Log2 mRNA fold difference:0.01273665620758
Log2 TE fold difference:-0.43506013527259
Sequences
Protein sequence

MGAARPRRWKLPFHRTVSAVGGGGGAPCSPSSRSSSSPARSEAWAAEAVPEEFLCPISGA
LMADPVILPSGKTFERACLQACAELAFLPPGVEAGDADTVIPNSALKAAICTWCARSGRE
VPAPPSAEAARQAVQRAMPPAAAKSVRTTTTRRAVVMAASTSNSSTSSYGSASEITAAED
EAKAKEEAPRRRTVKEAEVEPAAAPPADPLEDDVVGKVMDADDDGVVAAAMGALREATRE
GEERRRALCTPRLLGALRRVLLLPRHAAARVDAVAALVNLSLEPANKVRIVRAGAVPALV
EVLRSGASAPEAREHAAGALFGLALNEDNRAAIGVLGAVPPLLDLLTSPTHAPRARRDAG
MALYHLTLAAVNQSKVARFPGAPKALLAVASGAAEPGPIRRLALMVACNVAACAEGRNAL
MDAGGVASVSGILLSPSHDTTNGGGGTADLEEWCLSAMYAMSRGSLRFRGLALASGADRA
LRRVVADEGGGVRREIARKTLRAMRSDLDEDGGEYNDLTGSSAECGDGEDCGGSIVSDGL
MSFRRRQRELGVSSCGNTAEF*

MGAARPRRWKLPFHRTTSAPCSPSSRSSAPPPGPASPARSEAWVAQPVPEAFLCPISGAL
MADPVILPSGNTYERACLQACAELAFLPPGAEAGGLRTVIPNAALKAAIGTWCARSGRAG
PPPPPLSAEAARQAVLRAMPPAAARTTARRVAAVMAASTSNSSTSSYGSASEITAAEDEA
EAEAPADPLEDDVVGKVMRADDGSGGVVAAAMGALREATREGAERRLALCTPRLLGALRR
VLLLPRHAAARVDAAAALVNLSLEPGNKVRIVRAGAVPALVEVLRSAASAPEAREHAAGA
LFGLAIHEDNRAAIGVLGAVPPLLDLLASRAHPPRARRDAGMALYHLTLAAVNQSKVARF
PGAPKALLAVASGAADPGPVRRLALMVACNVAACAEGRNALMDAGAVASVSAILLSDGGA
AAAAAGLEEWCVSAMYAMSRGSLRFRGLARAAGADRALRRVVADEGGGVRREMARKTLRA
MRGDLDNDDGGTEYNNDLTGSSAECEDCGGSIVSDGLMSFRRRQRELGNTAEF*

www.000webhost.com

Other information
Ka divergence:0.159817KaKs divergence:0.012437
GC content 1 (%):74GC content 2 (%):76GC content divergence:0.013
Length 1 (bp):1686Length 2 (bp):1602Length divergence:-0.026
MFE 1 (kcal):-995.87MFE 2 (kcal):-957.5MFE divergence-0.02