Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G100212-GRMZM2G335593
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):verprolin

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.0388549712402
Log2 mRNA fold difference:2.8799349050314
Log2 TE fold difference:-1.674004938375
Sequences
Protein sequence

MASAARFLVAVVVACAVLASNNCHAARHLADTAAAPAAAGVVPGLPAVPTLPTLPPVPQV
ALPPMPAVPAVTVPQMTLPPMPAAPKVAVPLPPMPAVPSVLPKLTLPPMPVVVPSVVPKV
VLPPMPSVPTVPMPFAAPPPSA*

MASAARFLVVVVVACALLASNNCHAARHLADTAAAPAAAGAVPGLPAVPTLPTVQPVPQV
ALPPMPAVPAVTVPQMTLPPMPAAPKVAVPLPPMPAIPSVLPKLTLPPMPAVVPSVVPKV
ALPPMPSVPTVNVPMPFAGTASVGIDARGALLQVCVRRAHHVEQRWW*

Other information
Ka divergence:0.268847KaKs divergence:0.70406
GC content 1 (%):70GC content 2 (%):71GC content divergence:0.007
Length 1 (bp):429Length 2 (bp):504Length divergence:0.08
MFE 1 (kcal):-181MFE 2 (kcal):-227.66MFE divergence0.114