Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G100448-GRMZM2G122185
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.8123473512827
Log2 mRNA fold difference:-1.5005186929832
Log2 TE fold difference:0
Sequences
Protein sequence

MALTTRGGAGGGDPAKAPSASDPSLGFLTKRDTEVKLPRATRVKNKTPAPIQITAEQILR
EARERQEPEIRPPKQKITDPHELSDYRLRKRKEFEDVIRRVRWSVSAWVKYARWEEQQRD
FARARSVYERALDVAHRDHTLWLKYAEFEMRNRFVNHARNVWDRAVSLLPRVDQLWYKYI
HMEELLGAVANARQVFERWMSWRPDTAGWNSYIKFELRYGEVERARAIYERFVAEHPRPD
TFIRYAKFEMKLGEVERARRVYERAADLLADDEDAEVLFVAFAEFEERCREVERARAIYK
YALDRVPKGRAEELYRKFLAFEKQFGDREGIEDAIVGKRRFQYEDEVRKNPLNYDSWFDY
IRLEESVGNKDRIREVYERAIANVPPAEEKRYWQRYIYLWINYALYEELDAQDRERTREV
YKECLRLIPHKKFTFAKMWLMAAQFEIRQRNLKAARQILGNAIGMAPKGKIFKKYIEIEL
YLGNFDRCRTLYEKYIEWSPANCYAWRKYAELEKNLSETDRARSIYELAIAQPALDTPEV
LWKPKFNSSLGIGSILIEHESIESDNVLFRHEKLSLLLWAADDCEGLRVTAREYLQFEID
ENEFERTRQLYERLLDRTKHLKVWISYAEFEASAGLGGEDGEDKEKKNEVSYQEQQMERV
QKCRAVFERAFDYFRTSAPELKEERAMLLEEWLNKEVNFGDLGDVSLVQKKAPRKVKRKR
PIPTEDGSTIAYEEYIDYIFPDEVALAPNLKILEAAYKWKKQKTGDGDE*

MRRRRRPLPIPASAFSPSATPRSSYPAPIQITAEQILREARERQEPEIRPPKQKITDPQE
LSEYRLRKRKEFEDVIRRVRWSVSAWVKYARWEEQQLDFARARSVYERTLDVAHRDHTLW
LKYAEFEMRNRFVNHARNVWDRAVSLLPRVDQLWYKYIHMEELLGAVANARQVFERWMSW
RPDTAGWNSYIKFELRYGEVERARAIYERFVAEHPRPDTFIRYAKFEMKRGEVERARRVY
ERAADLLADDEDAEVLFVAFAEFEERCREVERARAIYKYALDRVPKGRAEELYRKFLAFE
KQFGDREGIEDAIVGKRRFQYEDEVRKNPLNYDSWFDYIRLEESVGNNDRIREVYERAIA
NVPPCRSAEEKRYWQRYIYLWINYALYEELDAQDRTDQGGLQGMPEADSSQEVHICKDVA
HGGPV*

Other information
Ka divergence:0.760368KaKs divergence:0.324026
GC content 1 (%):51GC content 2 (%):56GC content divergence:0.047
Length 1 (bp):2310Length 2 (bp):1278Length divergence:-0.288
MFE 1 (kcal):-812.88MFE 2 (kcal):-494.8MFE divergence-0.243