Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G100467-GRMZM2G411764
Species:maize
Duplication type:WGD
Function (paralog1):60S ribosomal protein L39
Function (paralog2):60S ribosomal protein L39

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.41746151840003
Log2 mRNA fold difference:0.1220491415413
Log2 TE fold difference:0.29684438427373
Sequences
Protein sequence

MPSHKTFRIKKKLAKKMRQNRPIPYWIRMRTDNTIRYNAKRRHWRRTKLGF*

YPPFHAFRLLGFSRRRRRRFVVSAAAMPSHKTFRIKKKLAKKMRQNRPIPYWIRMRTDNT
IRYNAKRRHWRRTKLGF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):59GC content 2 (%):62GC content divergence:0.025
Length 1 (bp):156Length 2 (bp):234Length divergence:0.2
MFE 1 (kcal):-47.56MFE 2 (kcal):-77.93MFE divergence0.242