Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G100620-GRMZM2G307906
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272589
Function (paralog2):hypothetical protein LOC100273898

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.9561233552122
Log2 mRNA fold difference:-0.82401722988314
Log2 TE fold difference:-1.2110267477058
Sequences
Protein sequence

MDREWGSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTL
HNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPAQPQPNKRKLAPRKSVKIGRPGYKVTKQ
YDPETKQHSFLFEIGYPEIEDNCKPRHRFMSSYEQKVQSWDKRYQYLLFAADPYEIIAFK
IPSTEIDKSASKFFSYWDPDKKEYLLQLYFKPRPPEGSKPPPAPPGTLPNGTGAPGAPPR
PPGQAPPPPPPQIPPPPPAPMGMPPRIPPPPIGAVQPPPPPARVANGLRPMIPPPPNFTP
GAPPPRPPMQGFPGQQQ*

MDREWGSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTL
HNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPAQPQPNKRKLAPRKSVKIGRPGYKVTKQ
YDPEMKQHSFLFEIGYPEIEDNCKPRHRFMSSYEQKVQSWDKGYQYLLFAAEPYEIIAFK
IPSTEIDKSANKFFSYWDPDKKEYLLQLYFKPRPPEANKPPPAPPGTLPNGTGVPGAPTR
PPAQAPPPLPQVPPPPPHAPPPAPMGMPPRIPPPPMGGVQPPPPPPPPVANGPRPMIPPP
PNFTPGAPPPRPPMHGFPGQQQQ*

www.000webhost.com

Other information
Ka divergence:-0.169522KaKs divergence:-0.237624
GC content 1 (%):56GC content 2 (%):56GC content divergence:0
Length 1 (bp):954Length 2 (bp):972Length divergence:0.009
MFE 1 (kcal):-323.37MFE 2 (kcal):-317.97MFE divergence-0.008