Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G100639-GRMZM2G162445
Species:maize
Duplication type:WGD
Function (paralog1):DNA replication licensing factor MCM3 homolog 2 (Replication origin activator 2)(ROA-2)
Function (paralog2):hypothetical protein LOC100193296

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.2025411308007
Log2 mRNA fold difference:-1.1609876574264
Log2 TE fold difference:-0.0044493327404848
Sequences
Protein sequence

MEINEEAMAAHKRAFLDFLDQDVGKGVYMQAVRDMVQNKRHRLIIGMDDLRNHNLDLARR
VIRTPGEYMQPASDAVSEVARNLDPKFLKEGERVMVGFSGPFGFHRVTPRDLMSSFIGTM
VCVEGIVTKCSLVRPKVVKSVHFCPVTGDFLSREYRDITSFVGLPTGSVYPTRDDNGNLL
VTEYGMCEYKDHQTLSMQEVPENSAPGQLPRTVDVIVEDDLVDCCKPGDRVSIVGVYKAL
PGKSKGSVSGVFRTVLIANNVSLLNKEANAPVYTREDLKRMKEISRRNDTFDLLGNSLAP
SIYGHLWIKKAVVLLMLGGVEKNLKNGTHLRGDINMMMVGDPSVAKSQLLRAVMNIAPLA
ISTTGRGSSGVGLTAAVTSDQETGERRLEAGAMVLADRGVVCIDEFDKMNDQDRVAIHEV
MEQQTVTIAKAGIHASLNARCSVIAAANPIYGTYDRSLTPTKNIGLPDSLLSRFDLLFIV
LDQMDPEIDRQISEHVARMHRYCTDDGGARSLDKEGYAEEDDGDANAAIFVKYDRMLHGQ
DRRRGKKSKQDRLTVKFLKKYIHYAKNLIQPRLTDEASDHIATSYAELRDGSANAKSGGG
TLPITARTLETIIRLSTAHAKMKLRHEVLKSDVEAALQVLNFAIYHKELTEMEEREQREM
EMKQQADHDAGATGGTVDGHGSSGNDPMDVDVGSNDQNVSAERIEAFEALLGQHVLANHI
DQMSIDDIEQMVNRESTAPYTRSQVEFILERMQDANRVMIRDGVVRII*

MDVNEEAMAAHKRAFLDFLDQDVGKGVYMQAVRDMVQNKRHRLIIGMDDLRNHNLDLARR
VIRSPGEYMQPASDAVSEVAKNLDPKFLKEGERVMVGFSGPFGFHRVTPRDLMSSFIGTM
VCVEGIVTKCSLVRPKVVKSVHFCPVTGAFLSREYRDITSFVGLPTGSVYPTRDDNGNLL
VTEYGMCEYKDHQTLSMQEVPENSAPGQLPRTVDVIVEDDLVDCCKPGDRVSIVGVYKAL
PGKSKGSVSGVFRTVLIANNVSLLNKEANAPVYTREDLKRMKEISRRNDTFDLLGNSLAP
SIYGHLWIKKAVVLLMLGGVEKNLKNGTHLRGDINMMMVGDPSVAKSQLLRAVMNIAPLA
ISTTGRGSSGVGLTAAVTSDQETGERRLEAGAMVLADRGVVCIDEFDKMNDQDRVAIHEV
MEQQTVTIAKAGIHASLNARCSVIAAANPIYGTYDRSLTPTKNIGLPDSLLSRFDLLFIV
LDQMDPEIDRQISEHVARMHRYCTDDGGARSLDKQGYAEEDDGDANAAIFVKYDRMLHGQ
DRRRGKKAKQDRLTVKFLKKYIHYAKNLIQPKLTDEASDHIATSYAELRDGSANAKSGGG
TLPITARTLETIIRLSTAHTKMKLRHEVLKSDVEAALQVLNFAIYHKELTEMEEREQREA
EMKQQADHDADATGGTVDGHGSSGNDPMDVDVGNTSNDQNVPLARMEAFEAFLGQHVLAN
HIDQMSIDEIEQVVNRESTAPYTRSQVEFILERMQDANRVMIRDGVVRII*

Other information
Ka divergence:0.154069KaKs divergence:0.0383838
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):2307Length 2 (bp):2313Length divergence:0.001
MFE 1 (kcal):-755.28MFE 2 (kcal):-734.29MFE divergence-0.014