Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G100872-GRMZM2G359735
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100216833
Function (paralog2):hypothetical protein LOC100383540

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.47330967946015
Log2 mRNA fold difference:0.039404182226231
Log2 TE fold difference:-0.74904923583935
Sequences
Protein sequence

MATAATAMVVPEQPRRRKPAPGRGGVALPAGLSEEEARVRAIAEIVSAMGELSRRGEDVD
LNALKSAACRRYGLARAPKLVEMIAAVPEADRAALLPRLRAKPVRTASGIAVVAVMSKPH
RCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKR
LGHSVDKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAICYSEHSAVKCIG
MTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDA
GFKVVAHMMPDLPNVGVERDLESFREFFESPAFRADGLKIYPTLVIRGTGLYELWKTGRY
RNYPPELLVDIVARILSMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLK
CRDVRTREAGIQDIHHKIRPDEVELVRRDYAANEGWETFLSYEDTRQDILIGLLRLRKCG
RNVTCPELVGRCSIVRELHVYGTAVPVHGRDVDKLQHQGYGTLLMEEAERIAQKEHRSEK
LAVISGVGTRHYYRKLGYELEGPYMVKCLA*

MARTRSGIPDERSHSTGIPQSQKARQNPLGGYPSLPMATAAAAAVAAPEQPRRRKPAPGR
GGVALPAGLSEEEARVRAIAEIVSAMGELSRRGEDVDLNSLKSAACRRYGLARAPKLVEM
IAAVPEADRATLLPRLRAKPVRTASGIAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVDKVEFILMGGTFMSLPAE
YRDYFIRNLHDALSGHTSANVEEAICYSEHSAVKCIGMTIETRPDYCLGPHLRQMLSYGC
TRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAHMMPDLPNVGVERDLES
FREFFGSPAFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPELLVDIVARILSLVPPWT
RVYRVQRDIPMPLVTSGVEKGNLRELALARMEDLGLKCRDVRTREAGIQDIHHKIRPDEV
ELVRRDYAANEGWETFLSYEDTRQDILIGLLRLRKCGRNVTCPELVGRCSIVRELHVYGT
AVPVHGRDVDKLQHQGYGTLLMEEAERIARKEHRSKKLAVISGVGTRHYYRKLGYELEGP
YMVKCLA*

Other information
Ka divergence:-0.158865KaKs divergence:-0.0610795
GC content 1 (%):53GC content 2 (%):53GC content divergence:0
Length 1 (bp):1713Length 2 (bp):1824Length divergence:0.031
MFE 1 (kcal):-674.56MFE 2 (kcal):-712.54MFE divergence0.027