Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G100898-GRMZM2G025059
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MDLDMDGYVDPYEEAAAEGDSDDPDEDDSDAESDYEEKSFGLLKSGKHRVRNPDGTFRCP
FCLGKKKQGYKIKDLLQHADGIGVSSKHRRHGRERANHRAFARFVRTDPSFAEDLVGITG
IQGAITTTPANENYSANGNGKAKANVDTAGSSSVAAKVGPPQEVERFAWPWACVLAAGAG
FNAEDFVGRVALFSSVEVVPLFVDEMEVTETFAIVRFTNDWSGFNDALTIENYFSVNKLG
KKEFQMRDSGLGSVEGDGEGDVKVYGWVARAEDYDATTVVGRFLRKHTVLQTIDEVSKTE
LEKSGEMVAILASQIEEKNRYLQDLETKKNATELSISRLEEDNRKLHEAYNEEMRNLHRR
ARENALRIFQENENLRIDLENKRRELNLRAKELEKMSAENANDRKTLDDQKQKTKYDNSE
LELASIEQQRADADVLKLLADQEREKEDVLARMLQLEKELHEKQQLELEVERLNGTLQVM
KHLEGDDDGGDIHEKMEKLSERFEREKKRLEDLSGDLVTKERESNDELQQARKELIKGLE
EELNGRTAVGIKRMGELDEKPFLNACKRKYGNNEYQVKAAELVTNWQEELKNPSWYPFKM
IHVDGEDKEILVDDDTKLKFLWIEFGDDVCNAVKTALMEINEYNPSGRYVVPELWNFRKG
RKATMKEVLKYLFSQMDTTTKRRRG*

MDLDLDDYVDPYEEAEAEAAAAEDGSDDPDEDDSDAESDYEEESFGLLKSGKHRVRNPDG
TFRCPFCPGKKKQGYKIKDLLQHADGIGVSSKHRRHGRERANHRAFARFVRTEPSFAEDL
VGITGIQGAIKPTPANRDGSTNGDGKAKANVDTAGSSSVAAKVGLPREVERFSWPWACVL
AAGAGFNTEDFAGRVAMFSSVEVVPLFVDEVEVAETFAVVRFTNDWSGFSDALTLENHFS
INKLGKKEFEMRDNGIGSVEGDGGEGEVKVYGWVARAEDYDSPSVVGRFLRKHTVLKTID
EVSKTELEKSGEMVAILASKIEEKNRHLQDLETKKNATELSISRLEEDNRKLHEAYNEEM
RNLHRRARENALRIFQENENLRIDLESKKRELNLRAKELDKISTENANDRKTLDNEKQKA
KYDNSELELASIEQQRADADVLKLLADQEREKEDVLARMLQLEKELHEKQQLELEVERLN
GTLQVMKHLEGDDDGGDIHEKMEKLSERFEREKKRLEELSGDLVRKERESNDELQEARKE
LIKGLEEELNGRTAIGVKRMGELDEKPFQNACKTKYGKDEYEIKAAELVTSWQDELKKPS
WHPFKMVEVNGENKEILDDDDTKLKFLWIEYGDDVCNAVKTALMEINEYNPSGRYVVPEL
WNFRKGRKATVKEVLKYLFSQMDTTTKRRRG*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):49GC content 2 (%):50GC content divergence:0.01
Length 1 (bp):2058Length 2 (bp):2076Length divergence:0.004
MFE 1 (kcal):-678.52MFE 2 (kcal):-696.61MFE divergence0.013