Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G100911-GRMZM2G165428
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279756
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.19567466086489
Log2 mRNA fold difference:0.64909302608089
Log2 TE fold difference:-0.33015137700696
Sequences
Protein sequence

MASARLVALAAFLLLLLFALGPGEARAADDGEVRALLALGAALDPTGRLLPSWAPGRDPC
APAPSGGFEGVACDARGAVANVSLQGKGLAGTLPPAVAGLRSLTGLYLHYNALRGGIPRE
LAALAALTDLYLDVNNFSGPIPSEIGAMASLQVVQLCYNQLTGSIPTQLGNLTRLTVLAL
QSNRFNGAIPASLGDLPLLARLDLSFNRLFGSIPVRLAQLPCSLVVLDVRNNSLTGSVPA
ELAAKLQAGFQYGNNSDLCGAGLPALRPCTPADLIDPDRPQPFSAGIAPQVTPSDGRGNG
RVPSTRALAAVVVVAVALLLTTGVGLFALSWRRWHRQKVAGASPSTISGGRCSTEVVPSA
AKASSARKSASSALASLEYSNAWDPLADARGGLGFVSQDVQLAQSLRISTEEVESATRYF
SELNLLGGHGKKAGGLAATYRGTLRDGTSVAVKRLGKTCCRQEEADFLSGLRLLAELRHD
NVVALRGFCCSRARGECFLVYDFVPNGSLSQFLDADTTAGGSGRVLQWSTRISIIRGIAK
GIEYLHSTRTNKPALVHQNISADKVLLDYAYRPLVSGCGLHKLLVDDLVFSTLKASAAMG
YLAPEYTTVGRLSEKSDVYAFGVIVLQVLTGRRKVTATAQLLAGNVDDDELVDGNLQGSY
SAAEAAMLAKIGSACTSEDPDQRPTMAELLQELDTI*

MVSARLVALAAFHLLVLLAMGPGEARAADGGEVRALLALGAALDPTGRLLPSWAPGRDPC
APPPSGGFDGVACDDSGAVANVSLQGKGLAGTLPPAVAGLRSLTGLYLHYNALRGGIPRE
LAALAALTDLYLDVNNFSGPVPPEIGAMASLQVVQLCYNQLTGSIPTQLGNLSRLTVLAL
QSNRLNGAIPASLGDLPLLARLDLSFNRLFGSIPVRLAQLPSLVALDVRNNSLTGSVPAE
LAAKLQAGFQYGNNSDLCGAGLPALRPCTPADLIDPDRPQPFSAGIAPQVRPSDGRAPST
RALAAVVVVAVALLAATGVGLLALSWRRWRRQRVAGGSPSTVSGGRCSTEAAPSAAKASS
ARKSASSALASLEYSNAWDPLADARGGLGLFSQDALAQSLRISTEEVESATRYFSELNLL
GRRGKKAGGLAGTYRGTLRDGTSVAVKRLGKTCCRQEEADFLSGLRLLAELRHDNVVALR
GFCCSRARGECFLVYDFVPNGSLSQFLDVDADNAGGGSGRVLQWSTRISIIKGIAKGIEY
LHSTRTNKPALVHQNISADKVLLDYAYRPLISGCGLHKLLVDDLVFSTLKASAAMGYLAP
EYTTVGRFSEKSDVYAFGVIVFQVLTGKSKVTTTHAQLPDNDVDELVDGNLQGDNYSAAE
AAQLAKIGSACTSENPDQRPTMAELLQELSTV*

Other information
Ka divergence:-0.146471KaKs divergence:-0.190848
GC content 1 (%):70GC content 2 (%):70GC content divergence:0
Length 1 (bp):2091Length 2 (bp):2079Length divergence:-0.003
MFE 1 (kcal):-1059.45MFE 2 (kcal):-1077.34MFE divergence0.008