Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G101350-GRMZM2G176289
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100273484

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.8884122286157
Log2 mRNA fold difference:-3.2597805452563
Log2 TE fold difference:1.6798080685899
Sequences
Protein sequence

MARCQGTVESLCQGLLDLDDDKFGAMCSAFGYLQEWPDLGAAMCGANLAVPPAVATPSAG
DGNDSSSCSVSGGLRKRRPDAYLDAKGGANGMNKRPRGKQQPSGLSEIAAAPGKGKQERP
KAGTKKKAEAAAAAAAAGQKTDYIHVRARRGQATDSHSLAERVRRERISERMRYLQELVP
GCSKVTGKAGMLDEIINYVQSLQKQVEFLSMKIAASNPVVSFDIVEDLFGRQLKQACGPA
AGQLEPSCLQMSMSPMQQVVHPSAAAGSTGFGPLDMVLSNLYAPAAASCPVSAAPSVSVA
AGPSTIEPCLNVNGTAAAWDIGSQNLFSGFDAQFQSVESGCLLDNLKMEM*

MARCRGTAESLCQGRLDLDDDKFGAMCTTAFGCLQEWPDLGAMCGANLGVPAMAGNGNES
SCSGSGGSRKRKPDAYDGLDATGGANDMSKRPRGKRLSGISEIVAPGKGKQERPKAGTKK
KAEAASAAAAAAAAGHKTDYIHVRARRGQATDSHSLAERVRRERISERMRYLQELVPGCS
KVTGKAGMLDEIINYVQSLQKQVEFLSMKIAASNPVVSFDIVEDLFGRQLKQSRRSPAAA
LPAMALPAGQLEPSCLQMSHMPQMHPSAAANSTGFGLDMVVNNPYAPAGASCPVSAAASV
SVAAGPSTTEPCLNVNGTAAWDIGSRNLFSGFVAQFQSVESDCLLNNFKMEM*

Other information
Ka divergence:0.543322KaKs divergence:0.585052
GC content 1 (%):65GC content 2 (%):64GC content divergence:-0.008
Length 1 (bp):1053Length 2 (bp):1059Length divergence:0.003
MFE 1 (kcal):-507.9MFE 2 (kcal):-492.3MFE divergence-0.016