Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G101693-GRMZM2G162605
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273780
Function (paralog2):hypothetical protein LOC100192595

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.7078594479803
Log2 mRNA fold difference:4.3494602900792
Log2 TE fold difference:0
Sequences
Protein sequence

MSSSIISTVATELSVAEKSRGIEPLPFINDKHGGVIIEMTTPMDPGAFSASLKAALVKWR
EQGIRGVWIKLPITLSNLIPPVVEEGFWYHHAEETYLMLAYWLPNTTHTLPVNATHRVSV
GAFIMNDKREVLAVQEKSGVLRGLGVWKFPTGVVEPGEDINVGAVREVKEETGIDAEFVE
VLAFRQSHKSFFDKSDLFFVCLLRPLSYDITKQDSEIEACQWMPVEEFAAQPFVQKHELV
KYILEVGLAKVDKEYAGFSPISIKSAFTDKLSLFYMNRRDLDRASG*

MAAHSLSLYLPVVTRSLVPLAFRHLLLPHRLRLRLRLRLVSAVSPSRARPLGLGARPPRP
HAAPLGYGVGAGRRPSGGLDHRAMSSSTNSTVATELSVSENSREIEPLPFVNDKHGGVII
EMKTPMDPGVFSAYLKAALAKWREQGIRGVWIKLPITLSNLIPTVVEEGFWYHHAEETYL
MLAYWLPNTTHTLPVNATHRVGVGAFIMNDKREVLVVQEKSGVLRGLGVWKFPTGVVEPG
EDINVGAIREVKEETGIDAEFVEVLAFRQSHKAFFDKSDLFFVCLLRPLSYDITKQDSEI
EACQWMPVEEFAAQPFVQKHELVKYILEVGLAKVDKKYAGFSPISIKSAFTDKLSLFYMN
RRDLDKASG*

Other information
Ka divergence:-0.0303797KaKs divergence:-0.0251926
GC content 1 (%):45GC content 2 (%):51GC content divergence:0.063
Length 1 (bp):861Length 2 (bp):1110Length divergence:0.126
MFE 1 (kcal):-258.93MFE 2 (kcal):-369.2MFE divergence0.176