Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G101711-GRMZM2G446050
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.37136116071988
Log2 mRNA fold difference:-0.3009799349354
Log2 TE fold difference:0.67212188120345
Sequences
Protein sequence

MTAEGTACNGAGEAPKAEFVPEKVVTASLEEKAAGEREGEDVGGPFVVVNGGDSDGHSDR
GSDLGKASGEESSSEEEDVPGSNVAPDLAVGGDHGSARGEVSAQGAALGASSADGSGRAS
DGAEGGADEGKGEPSSDFDAEAAPQEDVGEEDGGAAALASSGCEPAITGADSEAAPAVDD
EVEGKEGTVDGSAVADVAEAVVHQEVSTEHDDALTLPKSSASMESEVIREDNKEQSTADI
VGPHEQGTCGASALVENEHLCADMRADSFVAVTEPDSQEDYAVESCMRDDVLICTESGSA
DIESEVNGKDSKQEQSNADVVEVIGQGVVRADALMANGHLCADIQADSSEAATKPDNIAN
ESKLTEVAESGEDAAASGELDAIDASSQTNGHIYVASGADSFIIASESKSHSFETDGQET
DQQEEEVPQTEAELLDGVLKPTERNCARSVEELIGEEVDTDGHPSVDGTADASGEQEAKP
MQVEGEATCGILEFEEVDKDGEDSLCNDCMVGVVSSNEETELPMKERTDEAVPSVNVGES
EQVTEDTSQDIMQGGLARGVFIGTIFVKPVSDPHVESSLVHKVKAEVHLVDEITAADLKA
ENMVEVKRTDREVDEIEVKAPGTHEIGNSSEVEPKEEFEMEVDDAVSLHEAAASASENGS
EEKSSNIAVDQVEPVNLNVDELAVDDDQPSFNPGYGSAKSSDVAETKNVEAQVTEQKGNA
HHASGEWHGDHTQVIGPQRIYIIKVPKFAGDDLWDKIQAAQAHLDQLTQERDAINRRRQK
QKAICDEYREKFEAARQEEREARAAHGDKKNDLNSVRSVLEKLHQANSVEELDELIAKKE
RIMQHETISLKEEKLLIKEINELKSQRKQLSATMGSKAEINEAFDQKDHIHERHKVLKKD
SDVLFSNLKVLEENTRKIQKSFADERTALRKLTEEHRAANEIRQKAYSDWTELRSEPSKK
NEYFFKYRDARNAAENFRANGDINGLISHCNSQIERVMEIWNKNEDFRKQYVESNKVSTL
KRLGTHDGRKLGPGEDPPVIPSRRPSNICPLSASSPEMITLASTPAPVLAAAAAVPSKEN
SFPALAAPQTSKRAKSKASGSSAQIKNKSVIVSEEEDLEQTLKEKAHQLELARKAEELDR
KAEELARKEEELRKERDAAEKERLRMEQKAKAKEAEERKRRKAEKDKERAEFKARKEAEE
REKKKAKRDKKKGAAPADSSAIGDSHAAASATADTDSNASDNPREADVSQPAVAPRRPAR
PAAAIKQLNRLQPMPAPLRNRGRRKLRQYILIAAAVLTVLALFVAGNYIPRLRSHS*

MTAEGTACNGAGEALKAEFAPEKVVAVSLEEKPVGEREGEDVGGPFLIVNGGDSDGHSEP
GSDLGKAPDEDPASEEDDVPTFNAAPDAAVAGDHGTAEGQVGAQGAALGASSADGGDRAS
DGSEGSADESRGDPSSDCVAEVAQQEAVGEEDSGAAALASRECEPTITSADSEAHYVDSE
VEDKEGTVDGSAVVDAVEAVVHQEASTEQDEDAAVMSSGHDDALTSPKSCSAAVESEVIR
EDSKEQSITDGVEPQQQGTVGASTLVENEHLCADMMADSFVAANEPDSQEDAAVMSSGHD
DALTSPKSCSAAVESEVIREDSKEQSITDGVEPQQQGTVGASALVENEHLCVDMAADSFV
AATEPDSQEDAAVESCGHDDLLTFTESGSADIESEVYGEDSEQKESNTVVVEIVVQGVGR
ADVLMANGHLCADTQAGSSEATTEPENHANGSKLTDVAESVEGDAGSGEQDTMDSSQTNG
HIYVALSADSCIVPSESKAHSFETDGQRTDQLQEEAPKLEAEVLEGVLKPTERNCAGSVE
KLIGEEVGTDGHASIGGTADAYGEQEAKPMQVEGEVTCGILEFEKVDKDGEEGLCDDYTV
GVVSSNEETELPMKEKVDEAVPSVNVGGPEKVTDNTSQDTKTVDFIDEITAESNFKAENM
VEVKSAAREVDKTEVKDLAFADEANVAPLHLQRDCESVMETIEHEKVELPGGCQAHEIVY
SSELEPKKEFEMGVDGAVPLQGAAASVASVFHHEPMSIDLSENDSGNHSGPTTALESCDH
VQNEESISQEISMTTIEQPIAIDQVEPVNLNVDELVVDDDQPGFAPRCESARLDKPGCTS
KKDDSNEIVEDSKSLENQLEICNAATMSDECSSRNANEDPSPINMSAECSSRTANEGFSP
INEASHLAEESCLSDKSYNAISYENGNGPAKSSEEPDKSCNAIICENENEPAKSSDVVET
RCVEALAPSSVGTVVTAEQKDNGHRASGEWHGDNVQVIGQQQKIYIIKVPKFAGDDLWNK
IQAAQAHLDHLTQERDAINRRRQKQKAVCDQYREKLEAARREEREARTAHGDKKNDLNNV
RSVLGKLHQANSAEELDELIAKKERTMQHETISLKEEKLLIKEINELKAQRKQLSTTMGS
KAEINEAFDQKDHIHERHKVLKKDSDVLLTNLKFLEENTRKIQKSFEDERTGLRKLTEEH
RAANEIRQKAYIEWTELRSEPSKKNEYFFRYRDDRNAAEIFRANGDINGLKSHCNSQIEG
VMEMWNKNEEFRKQYVESNKVSTLKRLGTHDGRKLGPDEDPPVISSRRPSSIYPLSASSP
GVATLASIPAPVVAAPAAVSAKEDSFPVLEAPQTSKRTKSKASDICAQTENNSVIVSEAE
ALEQTLKEKARLLEEQLELARKAEELARKEEELSKERAAAEKERLRMEQKAKAKEAEERK
RRKAEKDKEKAEFKARKEAEEREKKKAKKDKRRGTAPADSSLTGDGHAAALATADTDSNA
SDNPREAEAPQPAAAPKRLSRPAAAIKQLNRVQPMPAPLRNRGRRRLRQYILIAAAVLSG
LALFVAGNYIPRLKSVHS*

Other information
Ka divergence:0.0428381KaKs divergence:-0.173547
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):3951Length 2 (bp):4737Length divergence:0.09
MFE 1 (kcal):-1353.98MFE 2 (kcal):-1622.6MFE divergence0.09