Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G102088-GRMZM2G156013
Species:maize
Duplication type:WGD
Function (paralog1):serine/threonine protein kinase
Function (paralog2):serine/threonine protein kinase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.293213328403
Log2 mRNA fold difference:1.1078991912177
Log2 TE fold difference:0.17938202003769
Sequences
Protein sequence

MMAEGPNFAGMIGGHDNGGDFCDMAYYRKLGEGSNMSVDNLNSMQTSTHGGSIAMSVDNS
SVGSCDSHTRMLNHPGLKGPVVGNYSVGGHSIFRHGRVSHALSDDALAQALMDPRYPTET
LKDYEEWTIDLAKLHMGMPFAQGAFGKLYRGTYNGEDVAIKLLERPEADPERAGLMEQQF
VQEVMMLATLRHQNIVKFIGACRKPVVWCIVTEYAKGGSVRQFLAKRQNRSVPLKLAVKQ
ALDVARGMAYVHGLGFIHRDLKSDNLLISGDKSIKIADFGVARIEVKTEGMTPETGTYRW
MAPEMIQHRPYDQKVDVYSFGIVLWELITGMLPFANMTAVQAAFAVVNKGVRPAIPQDCL
PTLAEIMTRCWDPNPDVRPPFTEVVRMLEHAEMEILSTVRKARFRCCMSQPMTTD*

MMVEGPNFAGLIGGHDNGGNFCDMAYYRKLGEGSNMSIDSLNSMQTSTHGGSIAMSVDNS
SVGSCSSHTRMLNHPGLKGPVVGNYSVGGHSIFRHGRVSHALSDDALAQALMDPRYPTET
LKDYEEWTIDLAKLHMGMPFAQGAFGKLYRGTYNGEDVAIKLLERPEADPERAGLMEQQF
VQEVMMLATLRHQNIVKFIGACRKPVVWCIVTEYAKGGSVRQFLAKRQNRSVPLKLAVKQ
ALDVARGMAYVHGLGFIHRDLKSDNLLISGDKSIKIADFGVARIEVKTEGMTPETGTYRW
MAPEMIQHRPYDQKVDVYSFGIVLWELITGMLPFANMTAVQAAFAVVNKGVRPAIPQDCL
PTLGEIMTRCWDPNPDVRPPFTEVVRMLEHAEVEILSTVRKARFRCCISQPMTTD*

Other information
Ka divergence:-0.330892KaKs divergence:0.0841547
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):1248Length 2 (bp):1248Length divergence:0
MFE 1 (kcal):-453.12MFE 2 (kcal):-471.41MFE divergence0.02