Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G102138-GRMZM2G152189
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100383538

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.59455682307683
Log2 mRNA fold difference:-0.33828379450808
Log2 TE fold difference:1.0773482057606
Sequences
Protein sequence

MPSSSLAFLMALLLLSCSTTMSSAARYLEEETKPAPHPTTTTVPELPKPELPPHPTVPEL
PKPELPPHPTTVPELPKPELPPHPAVPELPKPELPHPAVPEVPKPELPHPEPEVPKPELP
PNPTVPEVPEHVPVVPKHEFPPLPEPELPPKPESHYPAVPDAKP*

MASKSTMRSLVLIMGLLLLSCSGMSSAARLLEEMAPKEEYPHPEVPELPKPELPPHPTVP
ELPKPDELPPHPVVPELPKPEVPVHPAVPELPKPEIPPHSTVPELPKPEMPELPKPEVPE
HPAVPELPKPELPPHPTVPELPKPEVPELPKPEVPEHPAVPELPKHELPPHPTVPELPKP
EVPELPKPEVPEHPAVPELPKPELPPHPTVPELPKPEVPAHTAVPEPEPELPKHELPPLP
EPELPLPPKAESHYPVPGMAKP*

www.000webhost.com

Other information
Ka divergence:-0.113072KaKs divergence:-0.322351
GC content 1 (%):66GC content 2 (%):67GC content divergence:0.008
Length 1 (bp):495Length 2 (bp):789Length divergence:0.229
MFE 1 (kcal):-165.15MFE 2 (kcal):-311.9MFE divergence0.308