Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G102238-GRMZM2G702229
Species:maize
Duplication type:WGD
Function (paralog1):acid phosphatase/vanadium-dependent haloperoxidase related
Function (paralog2):acid phosphatase/vanadium-dependent haloperoxidase related

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.33850903947077
Log2 mRNA fold difference:0.05714454156685
Log2 TE fold difference:-0.39531235065487
Sequences
Protein sequence

MGASLASAGLVNYPLVAALLAFALAQSSKFFTTWYKEGRWDARQLIASGGMPSSHSATVT
ALSVAVGIQEGFRSATFATALVFACVVMHDAFGVRLHAGKQAEVLNQIVYELPEEHPLSE
TKPLREILGHTVPQVVAGCILGILMAVVMLLALGRS*

METAASAARLVNYPLVAALLAFAVAQSSKFFTTWYKDGRWDARQFIASGGMPSSHSATVT
ALAVAVAIQEGFHSATFATALVFACVVMHDAFGVRLHAGKQAEVLNQIVYELPEEHPLSE
TKPLREILGHTVPQVVAGCILGVLMAAVMHLSLGSS*

Other information
Ka divergence:-0.175735KaKs divergence:-0.0588839
GC content 1 (%):53GC content 2 (%):53GC content divergence:0
Length 1 (bp):471Length 2 (bp):471Length divergence:0
MFE 1 (kcal):-165.68MFE 2 (kcal):-175.21MFE divergence0.028